Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ABKA22_RS11165 | Genome accession | NZ_CP157287 |
| Coordinates | 2212910..2213206 (-) | Length | 98 a.a. |
| NCBI ID | WP_212715809.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain BIM B-1834 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2207910..2218206
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABKA22_RS11125 (ABKA22_11125) | - | 2208429..2209238 (-) | 810 | WP_014570791.1 | metal ABC transporter permease | - |
| ABKA22_RS11130 (ABKA22_11130) | - | 2209231..2209968 (-) | 738 | WP_058221575.1 | metal ABC transporter ATP-binding protein | - |
| ABKA22_RS11135 (ABKA22_11135) | - | 2210145..2210987 (-) | 843 | WP_251906093.1 | metal ABC transporter substrate-binding protein | - |
| ABKA22_RS11140 (ABKA22_11140) | - | 2210984..2211421 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| ABKA22_RS11145 (ABKA22_11145) | comGG | 2211519..2211803 (-) | 285 | WP_003129993.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABKA22_RS11150 (ABKA22_11150) | comGF | 2211842..2212288 (-) | 447 | WP_029344525.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ABKA22_RS11155 (ABKA22_11155) | comGE | 2212251..2212547 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ABKA22_RS11160 (ABKA22_11160) | comGD | 2212519..2212950 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ABKA22_RS11165 (ABKA22_11165) | comGC | 2212910..2213206 (-) | 297 | WP_212715809.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ABKA22_RS11175 (ABKA22_11175) | - | 2213579..2213644 (-) | 66 | WP_228762923.1 | hypothetical protein | - |
| ABKA22_RS11180 (ABKA22_11180) | - | 2214119..2214898 (-) | 780 | WP_348619035.1 | peptidoglycan amidohydrolase family protein | - |
| ABKA22_RS11185 (ABKA22_11185) | - | 2214898..2215197 (-) | 300 | WP_010905918.1 | phage holin | - |
| ABKA22_RS11190 (ABKA22_11190) | - | 2215210..2215434 (-) | 225 | WP_023189750.1 | hemolysin XhlA family protein | - |
| ABKA22_RS11195 (ABKA22_11195) | - | 2215447..2215683 (-) | 237 | WP_025017282.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 98 a.a. Molecular weight: 11157.84 Da Isoelectric Point: 4.2213
>NTDB_id=904057 ABKA22_RS11165 WP_212715809.1 2212910..2213206(-) (comGC) [Lactococcus lactis strain BIM B-1834]
MSFLVTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQIS
AYDNYYDQNKNEERNFND
MSFLVTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQIS
AYDNYYDQNKNEERNFND
Nucleotide
Download Length: 297 bp
>NTDB_id=904057 ABKA22_RS11165 WP_212715809.1 2212910..2213206(-) (comGC) [Lactococcus lactis strain BIM B-1834]
ATGAGTTTTTTAGTTACCTTAATTGAGATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAA
TTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTT
ATGAATTAGATCATGATGATGAGAAGCCGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCT
GCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAG
ATGAGTTTTTTAGTTACCTTAATTGAGATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAA
TTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTT
ATGAATTAGATCATGATGATGAGAAGCCGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCT
GCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
89.247 |
94.898 |
0.847 |
| comGC/cglC | Streptococcus mitis SK321 |
53.333 |
100 |
0.571 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.914 |
94.898 |
0.531 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.914 |
94.898 |
0.531 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.914 |
94.898 |
0.531 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.914 |
94.898 |
0.531 |
| comGC | Streptococcus mutans UA140 |
56.667 |
91.837 |
0.52 |
| comGC | Streptococcus mutans UA159 |
56.667 |
91.837 |
0.52 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
54.839 |
94.898 |
0.52 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
57.303 |
90.816 |
0.52 |
| comGC | Streptococcus suis isolate S10 |
59.74 |
78.571 |
0.469 |