Detailed information NTG0904057

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ABKA22_RS11165
• Genome accession: NZ_CP157287
• Coordinates: 2212910..2213206 (-)
• Length: 98 a.a.
• NCBI ID: WP_212715809.1
• Uniprot ID: -
• Organism: Lactococcus lactis strain BIM B-1834
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2207910..2218206

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABKA22_RS11125 (ABKA22_11125)	-	2208429..2209238 (-)	810	WP_014570791.1	metal ABC transporter permease	-
ABKA22_RS11130 (ABKA22_11130)	-	2209231..2209968 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
ABKA22_RS11135 (ABKA22_11135)	-	2210145..2210987 (-)	843	WP_251906093.1	metal ABC transporter substrate-binding protein	-
ABKA22_RS11140 (ABKA22_11140)	-	2210984..2211421 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
ABKA22_RS11145 (ABKA22_11145)	comGG	2211519..2211803 (-)	285	WP_003129993.1	competence type IV pilus minor pilin ComGG	Machinery gene
ABKA22_RS11150 (ABKA22_11150)	comGF	2211842..2212288 (-)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
ABKA22_RS11155 (ABKA22_11155)	comGE	2212251..2212547 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
ABKA22_RS11160 (ABKA22_11160)	comGD	2212519..2212950 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
ABKA22_RS11165 (ABKA22_11165)	comGC	2212910..2213206 (-)	297	WP_212715809.1	competence type IV pilus major pilin ComGC	Machinery gene
ABKA22_RS11175 (ABKA22_11175)	-	2213579..2213644 (-)	66	WP_228762923.1	hypothetical protein	-
ABKA22_RS11180 (ABKA22_11180)	-	2214119..2214898 (-)	780	WP_348619035.1	peptidoglycan amidohydrolase family protein	-
ABKA22_RS11185 (ABKA22_11185)	-	2214898..2215197 (-)	300	WP_010905918.1	phage holin	-
ABKA22_RS11190 (ABKA22_11190)	-	2215210..2215434 (-)	225	WP_023189750.1	hemolysin XhlA family protein	-
ABKA22_RS11195 (ABKA22_11195)	-	2215447..2215683 (-)	237	WP_025017282.1	hypothetical protein	-

Sequence

Protein

• Length: 98 a.a.
• Molecular weight: 11157.84 Da
• Isoelectric Point: 4.2213

>NTDB_id=904057 ABKA22_RS11165 WP_212715809.1 2212910..2213206(-) (comGC) [Lactococcus lactis strain BIM B-1834]
MSFLVTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQIS
AYDNYYDQNKNEERNFND

Nucleotide

• Length: 297 bp

>NTDB_id=904057 ABKA22_RS11165 WP_212715809.1 2212910..2213206(-) (comGC) [Lactococcus lactis strain BIM B-1834]
ATGAGTTTTTTAGTTACCTTAATTGAGATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAA
TTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTT
ATGAATTAGATCATGATGATGAGAAGCCGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCT
GCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	89.247	94.898	0.847
comGC/cglC	Streptococcus mitis SK321	53.333	100	0.571
comGC/cglC	Streptococcus pneumoniae D39	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae R6	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae TIGR4	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae Rx1	55.914	94.898	0.531
comGC	Streptococcus mutans UA140	56.667	91.837	0.52
comGC	Streptococcus mutans UA159	56.667	91.837	0.52
comGC/cglC	Streptococcus mitis NCTC 12261	54.839	94.898	0.52
comGC	Streptococcus gordonii str. Challis substr. CH1	57.303	90.816	0.52
comGC	Streptococcus suis isolate S10	59.74	78.571	0.469