Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABKA22_RS11145 Genome accession   NZ_CP157287
Coordinates   2211519..2211803 (-) Length   94 a.a.
NCBI ID   WP_003129993.1    Uniprot ID   -
Organism   Lactococcus lactis strain BIM B-1834     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2206519..2216803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABKA22_RS11115 (ABKA22_11115) - 2206943..2207320 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  ABKA22_RS11120 (ABKA22_11120) - 2207524..2208390 (+) 867 WP_003129984.1 RluA family pseudouridine synthase -
  ABKA22_RS11125 (ABKA22_11125) - 2208429..2209238 (-) 810 WP_014570791.1 metal ABC transporter permease -
  ABKA22_RS11130 (ABKA22_11130) - 2209231..2209968 (-) 738 WP_058221575.1 metal ABC transporter ATP-binding protein -
  ABKA22_RS11135 (ABKA22_11135) - 2210145..2210987 (-) 843 WP_251906093.1 metal ABC transporter substrate-binding protein -
  ABKA22_RS11140 (ABKA22_11140) - 2210984..2211421 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  ABKA22_RS11145 (ABKA22_11145) comGG 2211519..2211803 (-) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABKA22_RS11150 (ABKA22_11150) comGF 2211842..2212288 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABKA22_RS11155 (ABKA22_11155) comGE 2212251..2212547 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABKA22_RS11160 (ABKA22_11160) comGD 2212519..2212950 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABKA22_RS11165 (ABKA22_11165) comGC 2212910..2213206 (-) 297 WP_212715809.1 competence type IV pilus major pilin ComGC Machinery gene
  ABKA22_RS11175 (ABKA22_11175) - 2213579..2213644 (-) 66 WP_228762923.1 hypothetical protein -
  ABKA22_RS11180 (ABKA22_11180) - 2214119..2214898 (-) 780 WP_348619035.1 peptidoglycan amidohydrolase family protein -
  ABKA22_RS11185 (ABKA22_11185) - 2214898..2215197 (-) 300 WP_010905918.1 phage holin -
  ABKA22_RS11190 (ABKA22_11190) - 2215210..2215434 (-) 225 WP_023189750.1 hemolysin XhlA family protein -
  ABKA22_RS11195 (ABKA22_11195) - 2215447..2215683 (-) 237 WP_025017282.1 hypothetical protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=904053 ABKA22_RS11145 WP_003129993.1 2211519..2211803(-) (comGG) [Lactococcus lactis strain BIM B-1834]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=904053 ABKA22_RS11145 WP_003129993.1 2211519..2211803(-) (comGG) [Lactococcus lactis strain BIM B-1834]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585