Detailed information NTG0903592

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SGN29_RS07280
• Genome accession: NZ_CP138576
• Coordinates: 1534996..1535307 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain MFDS1022333
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1529996..1540307

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SGN29_RS07245	gcvPA	1530498..1531844 (-)	1347	WP_045177127.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SGN29_RS07250	gcvT	1531864..1532955 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
SGN29_RS07255	-	1533114..1533638 (-)	525	WP_001015121.1	shikimate kinase	-
SGN29_RS07260	-	1533628..1533774 (-)	147	WP_001789879.1	hypothetical protein	-
SGN29_RS07265	comGF	1533871..1534368 (-)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
SGN29_RS07270	comGE	1534286..1534585 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
SGN29_RS07275	comGD	1534572..1535018 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
SGN29_RS07280	comGC	1534996..1535307 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
SGN29_RS07285	comGB	1535321..1536391 (-)	1071	WP_045176802.1	competence type IV pilus assembly protein ComGB	Machinery gene
SGN29_RS07290	comGA	1536363..1537337 (-)	975	WP_069995863.1	competence type IV pilus ATPase ComGA	Machinery gene
SGN29_RS07295	-	1537389..1538012 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
SGN29_RS07300	-	1538009..1538338 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
SGN29_RS07305	-	1538338..1539324 (-)	987	WP_000161314.1	ROK family glucokinase	-
SGN29_RS07310	-	1539321..1539524 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=903592 SGN29_RS07280 WP_000472256.1 1534996..1535307(-) (comGC) [Staphylococcus aureus strain MFDS1022333]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=903592 SGN29_RS07280 WP_000472256.1 1534996..1535307(-) (comGC) [Staphylococcus aureus strain MFDS1022333]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369