Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SGW13_RS04015 | Genome accession | NZ_CP138502 |
| Coordinates | 781274..781705 (+) | Length | 143 a.a. |
| NCBI ID | WP_323052247.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain AF2019 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 771430..812460 | 781274..781705 | within | 0 |
Gene organization within MGE regions
Location: 771430..812460
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGW13_RS03940 (SGW13_03940) | - | 771430..772605 (-) | 1176 | WP_323052419.1 | tyrosine-type recombinase/integrase | - |
| SGW13_RS03945 (SGW13_03945) | - | 772693..772962 (-) | 270 | WP_323052420.1 | hypothetical protein | - |
| SGW13_RS03950 (SGW13_03950) | - | 773262..774221 (-) | 960 | WP_323052421.1 | hypothetical protein | - |
| SGW13_RS03955 (SGW13_03955) | - | 774234..775259 (-) | 1026 | WP_323052422.1 | hypothetical protein | - |
| SGW13_RS03960 (SGW13_03960) | - | 775283..775948 (-) | 666 | WP_159218457.1 | LexA family protein | - |
| SGW13_RS03965 (SGW13_03965) | - | 776090..776353 (+) | 264 | WP_229038662.1 | helix-turn-helix transcriptional regulator | - |
| SGW13_RS03970 (SGW13_03970) | - | 776350..776565 (+) | 216 | WP_323052423.1 | hypothetical protein | - |
| SGW13_RS03975 (SGW13_03975) | - | 776650..777114 (+) | 465 | WP_323052424.1 | helix-turn-helix transcriptional regulator | - |
| SGW13_RS03980 (SGW13_03980) | - | 777115..777396 (+) | 282 | WP_065124807.1 | hypothetical protein | - |
| SGW13_RS03985 (SGW13_03985) | - | 777398..777541 (+) | 144 | WP_157420393.1 | hypothetical protein | - |
| SGW13_RS03990 (SGW13_03990) | - | 777634..778527 (+) | 894 | WP_065124806.1 | DUF1351 domain-containing protein | - |
| SGW13_RS03995 (SGW13_03995) | - | 778530..779366 (+) | 837 | WP_065124805.1 | ERF family protein | - |
| SGW13_RS04000 (SGW13_04000) | - | 779359..780192 (+) | 834 | WP_065124804.1 | helix-turn-helix domain-containing protein | - |
| SGW13_RS04005 (SGW13_04005) | - | 780197..780919 (+) | 723 | WP_021361655.1 | putative HNHc nuclease | - |
| SGW13_RS04010 (SGW13_04010) | - | 780864..781271 (+) | 408 | WP_032540532.1 | hypothetical protein | - |
| SGW13_RS04015 (SGW13_04015) | ssb | 781274..781705 (+) | 432 | WP_323052247.1 | single-stranded DNA-binding protein | Machinery gene |
| SGW13_RS04020 (SGW13_04020) | - | 781876..782040 (-) | 165 | WP_159208625.1 | YjzC family protein | - |
| SGW13_RS04025 (SGW13_04025) | - | 782179..782370 (+) | 192 | WP_159206544.1 | helix-turn-helix domain-containing protein | - |
| SGW13_RS04030 (SGW13_04030) | - | 782378..782569 (+) | 192 | WP_159208624.1 | hypothetical protein | - |
| SGW13_RS04035 (SGW13_04035) | - | 782562..782756 (+) | 195 | WP_159208623.1 | hypothetical protein | - |
| SGW13_RS04040 (SGW13_04040) | - | 782753..782989 (+) | 237 | WP_159208622.1 | hypothetical protein | - |
| SGW13_RS04045 (SGW13_04045) | - | 783058..783252 (+) | 195 | WP_138492706.1 | hypothetical protein | - |
| SGW13_RS04050 (SGW13_04050) | - | 783257..783556 (+) | 300 | WP_159208621.1 | MazG-like family protein | - |
| SGW13_RS04055 (SGW13_04055) | - | 783896..784327 (+) | 432 | WP_065124799.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SGW13_RS04065 (SGW13_04065) | - | 784713..784877 (+) | 165 | WP_323052425.1 | hypothetical protein | - |
| SGW13_RS04070 (SGW13_04070) | - | 784882..785133 (+) | 252 | WP_323052426.1 | hypothetical protein | - |
| SGW13_RS04075 (SGW13_04075) | - | 785140..785829 (+) | 690 | WP_323052427.1 | terminase gpP N-terminus-related DNA-binding protein | - |
| SGW13_RS04080 (SGW13_04080) | - | 785816..787123 (+) | 1308 | WP_159225210.1 | PBSX family phage terminase large subunit | - |
| SGW13_RS04085 (SGW13_04085) | - | 787136..788690 (+) | 1555 | Protein_779 | phage portal protein | - |
| SGW13_RS04090 (SGW13_04090) | - | 788690..789823 (+) | 1134 | WP_323052429.1 | phage minor capsid protein | - |
| SGW13_RS04095 (SGW13_04095) | - | 789920..790477 (+) | 558 | WP_159225207.1 | phage scaffolding protein | - |
| SGW13_RS04100 (SGW13_04100) | - | 790489..791385 (+) | 897 | WP_159208928.1 | hypothetical protein | - |
| SGW13_RS04105 (SGW13_04105) | - | 791457..791876 (+) | 420 | WP_159208927.1 | hypothetical protein | - |
| SGW13_RS04110 (SGW13_04110) | - | 791873..792223 (+) | 351 | WP_195304728.1 | putative minor capsid protein | - |
| SGW13_RS04115 (SGW13_04115) | - | 792223..792567 (+) | 345 | WP_323052430.1 | minor capsid protein | - |
| SGW13_RS04120 (SGW13_04120) | - | 792568..792963 (+) | 396 | WP_152688855.1 | minor capsid protein | - |
| SGW13_RS04125 (SGW13_04125) | - | 792975..793508 (+) | 534 | WP_159208925.1 | phage tail tube protein | - |
| SGW13_RS04130 (SGW13_04130) | - | 793585..794046 (+) | 462 | WP_152688856.1 | Ig domain-containing protein | - |
| SGW13_RS04135 (SGW13_04135) | - | 794121..794513 (+) | 393 | WP_159216905.1 | hypothetical protein | - |
| SGW13_RS04140 (SGW13_04140) | - | 794523..795152 (+) | 630 | WP_268814428.1 | Gp15 family bacteriophage protein | - |
| SGW13_RS04145 (SGW13_04145) | - | 795186..800807 (+) | 5622 | WP_323052431.1 | tape measure protein | - |
| SGW13_RS04150 (SGW13_04150) | - | 800809..801633 (+) | 825 | WP_323052432.1 | phage tail domain-containing protein | - |
| SGW13_RS04155 (SGW13_04155) | - | 801645..802760 (+) | 1116 | WP_323052433.1 | prophage endopeptidase tail family protein | - |
| SGW13_RS04160 (SGW13_04160) | - | 802753..803004 (+) | 252 | WP_271900566.1 | hypothetical protein | - |
| SGW13_RS04165 (SGW13_04165) | - | 803007..803276 (+) | 270 | WP_323052434.1 | hypothetical protein | - |
| SGW13_RS04170 (SGW13_04170) | - | 803278..805143 (+) | 1866 | WP_323052435.1 | metallophosphoesterase | - |
| SGW13_RS04175 (SGW13_04175) | - | 805160..805897 (+) | 738 | WP_323052436.1 | hypothetical protein | - |
| SGW13_RS04180 (SGW13_04180) | - | 805897..806235 (+) | 339 | WP_323052437.1 | DUF2977 domain-containing protein | - |
| SGW13_RS04185 (SGW13_04185) | - | 806235..806387 (+) | 153 | WP_323052438.1 | XkdX family protein | - |
| SGW13_RS04190 (SGW13_04190) | - | 806431..806691 (+) | 261 | WP_323052439.1 | hypothetical protein | - |
| SGW13_RS04195 (SGW13_04195) | - | 806695..807057 (+) | 363 | WP_323052440.1 | hypothetical protein | - |
| SGW13_RS04200 (SGW13_04200) | - | 807062..808429 (+) | 1368 | WP_323052441.1 | GH25 family lysozyme | - |
| SGW13_RS04205 (SGW13_04205) | - | 808525..809229 (+) | 705 | WP_323052442.1 | Fic family protein | - |
| SGW13_RS04210 (SGW13_04210) | - | 809285..809443 (+) | 159 | WP_323052443.1 | hypothetical protein | - |
| SGW13_RS04215 (SGW13_04215) | - | 809891..810211 (+) | 321 | WP_323052444.1 | acetyl-CoA carboxylase | - |
| SGW13_RS04220 (SGW13_04220) | - | 810556..811440 (-) | 885 | WP_232457164.1 | hypothetical protein | - |
| SGW13_RS04225 (SGW13_04225) | - | 811561..812460 (-) | 900 | WP_065124774.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 16094.76 Da Isoelectric Point: 4.8890
>NTDB_id=903198 SGW13_RS04015 WP_323052247.1 781274..781705(+) (ssb) [Pediococcus acidilactici strain AF2019]
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENLCNFTHKGSLVGIDGRIQTS
TYEKEGQRVYSTQVVVDSFSLLEPKQQSQQRGQQSNASDALHDNFGQPTNNNDFDIDDNDLPF
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENLCNFTHKGSLVGIDGRIQTS
TYEKEGQRVYSTQVVVDSFSLLEPKQQSQQRGQQSNASDALHDNFGQPTNNNDFDIDDNDLPF
Nucleotide
Download Length: 432 bp
>NTDB_id=903198 SGW13_RS04015 WP_323052247.1 781274..781705(+) (ssb) [Pediococcus acidilactici strain AF2019]
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGACAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTATGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGACGGTCGGATTCAAACGAGT
ACGTACGAAAAGGAAGGCCAGCGTGTTTACTCAACCCAGGTGGTTGTAGATAGCTTTTCGCTGTTGGAACCAAAGCAACA
AAGCCAACAACGTGGCCAACAATCCAATGCTAGCGATGCTTTGCATGACAATTTCGGACAGCCTACTAACAATAACGATT
TTGATATTGATGACAACGATCTGCCATTTTAG
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGACAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTATGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGACGGTCGGATTCAAACGAGT
ACGTACGAAAAGGAAGGCCAGCGTGTTTACTCAACCCAGGTGGTTGTAGATAGCTTTTCGCTGTTGGAACCAAAGCAACA
AAGCCAACAACGTGGCCAACAATCCAATGCTAGCGATGCTTTGCATGACAATTTCGGACAGCCTACTAACAATAACGATT
TTGATATTGATGACAACGATCTGCCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.529 |
100 |
0.636 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.458 |
100 |
0.587 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.42 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.545 |
76.923 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.86 |
100 |
0.399 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.86 |
100 |
0.399 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.161 |
100 |
0.392 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.161 |
100 |
0.392 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.161 |
100 |
0.392 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.161 |
100 |
0.392 |