Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RX142_RS02345 | Genome accession | NZ_CP136341 |
| Coordinates | 458792..459250 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain ES-397 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 433842..492507 | 458792..459250 | within | 0 |
Gene organization within MGE regions
Location: 433842..492507
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RX142_RS02195 (RX142_02195) | - | 436774..437613 (-) | 840 | WP_049142639.1 | LysM domain-containing protein | - |
| RX142_RS02200 (RX142_02200) | - | 437758..438003 (+) | 246 | WP_049142638.1 | hypothetical protein | - |
| RX142_RS02205 (RX142_02205) | - | 438066..438488 (+) | 423 | WP_049142637.1 | hypothetical protein | - |
| RX142_RS02210 (RX142_02210) | - | 438582..438899 (-) | 318 | WP_049142636.1 | hypothetical protein | - |
| RX142_RS02215 (RX142_02215) | - | 438926..439132 (-) | 207 | WP_049142635.1 | hypothetical protein | - |
| RX142_RS02220 (RX142_02220) | - | 439113..439295 (-) | 183 | WP_049142634.1 | hypothetical protein | - |
| RX142_RS02225 (RX142_02225) | - | 439309..439659 (-) | 351 | WP_049142633.1 | hypothetical protein | - |
| RX142_RS02230 (RX142_02230) | - | 439685..439987 (-) | 303 | WP_049142632.1 | hypothetical protein | - |
| RX142_RS02235 (RX142_02235) | - | 439990..440223 (-) | 234 | WP_049142631.1 | hypothetical protein | - |
| RX142_RS02240 (RX142_02240) | - | 441127..441657 (-) | 531 | WP_228394825.1 | hypothetical protein | - |
| RX142_RS02245 (RX142_02245) | - | 441654..442769 (-) | 1116 | WP_049142629.1 | replication initiator protein A | - |
| RX142_RS02250 (RX142_02250) | - | 442775..443173 (-) | 399 | WP_049142628.1 | replication initiator protein A | - |
| RX142_RS02255 (RX142_02255) | - | 443868..444088 (+) | 221 | Protein_422 | hypothetical protein | - |
| RX142_RS02260 (RX142_02260) | - | 444413..444658 (-) | 246 | WP_002358448.1 | helix-turn-helix domain-containing protein | - |
| RX142_RS02265 (RX142_02265) | - | 444652..445053 (-) | 402 | WP_002358449.1 | RNA polymerase sigma factor | - |
| RX142_RS02270 (RX142_02270) | - | 445611..445966 (+) | 356 | Protein_425 | sigma-70 family RNA polymerase sigma factor | - |
| RX142_RS02275 (RX142_02275) | - | 447050..450955 (+) | 3906 | WP_396336035.1 | LPXTG-anchored aggregation substance | - |
| RX142_RS02280 (RX142_02280) | prgU | 451017..451370 (+) | 354 | WP_002379922.1 | pheromone response system RNA-binding regulator PrgU | - |
| RX142_RS02285 (RX142_02285) | - | 451392..451778 (+) | 387 | WP_002389861.1 | hypothetical protein | - |
| RX142_RS02290 (RX142_02290) | - | 451847..452107 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| RX142_RS02295 (RX142_02295) | - | 452118..452996 (+) | 879 | WP_316498890.1 | hypothetical protein | - |
| RX142_RS02300 (RX142_02300) | - | 453016..453876 (+) | 861 | WP_010714270.1 | LPXTG cell wall anchor domain-containing protein | - |
| RX142_RS02305 (RX142_02305) | - | 453902..455173 (+) | 1272 | WP_002409353.1 | CHAP domain-containing protein | - |
| RX142_RS02310 (RX142_02310) | - | 455176..455793 (+) | 618 | WP_002409352.1 | hypothetical protein | - |
| RX142_RS02315 (RX142_02315) | - | 455777..456193 (+) | 417 | WP_002406548.1 | thioredoxin domain-containing protein | - |
| RX142_RS02320 (RX142_02320) | - | 456193..456507 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| RX142_RS02325 (RX142_02325) | - | 456500..457534 (+) | 1035 | WP_002385553.1 | conjugal transfer protein | - |
| RX142_RS02330 (RX142_02330) | - | 457539..457799 (+) | 261 | WP_010706916.1 | hypothetical protein | - |
| RX142_RS02335 (RX142_02335) | - | 457799..458188 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| RX142_RS02340 (RX142_02340) | - | 458220..458702 (+) | 483 | WP_002360790.1 | hypothetical protein | - |
| RX142_RS02345 (RX142_02345) | ssb | 458792..459250 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| RX142_RS02350 (RX142_02350) | - | 459355..461847 (+) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| RX142_RS02355 (RX142_02355) | - | 461804..462202 (+) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| RX142_RS02360 (RX142_02360) | - | 462215..464560 (+) | 2346 | WP_002377940.1 | CD3337/EF1877 family mobilome membrane protein | - |
| RX142_RS02365 (RX142_02365) | - | 464547..466805 (+) | 2259 | WP_316498891.1 | TraM recognition domain-containing protein | - |
| RX142_RS02370 (RX142_02370) | - | 467328..468113 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| RX142_RS02375 (RX142_02375) | - | 468119..468607 (+) | 489 | WP_010710133.1 | hypothetical protein | - |
| RX142_RS02380 (RX142_02380) | - | 469199..469465 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| RX142_RS02385 (RX142_02385) | - | 469498..469998 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| RX142_RS02390 (RX142_02390) | - | 470011..470259 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| RX142_RS02395 (RX142_02395) | - | 470335..470751 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| RX142_RS02400 (RX142_02400) | - | 470775..471359 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| RX142_RS02405 (RX142_02405) | - | 471470..471736 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| RX142_RS02410 (RX142_02410) | - | 471729..472004 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| RX142_RS02415 (RX142_02415) | - | 472195..472839 (-) | 645 | WP_002289351.1 | IS6 family transposase | - |
| RX142_RS02420 (RX142_02420) | bsh | 473063..474037 (+) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| RX142_RS02425 (RX142_02425) | - | 474706..475314 (-) | 609 | Protein_456 | IS6 family transposase | - |
| RX142_RS02430 (RX142_02430) | - | 475346..475531 (-) | 186 | WP_002358660.1 | hypothetical protein | - |
| RX142_RS02435 (RX142_02435) | - | 475621..475890 (+) | 270 | Protein_458 | LPXTG cell wall anchor domain-containing protein | - |
| RX142_RS02440 (RX142_02440) | - | 476018..476956 (+) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| RX142_RS02445 (RX142_02445) | - | 476982..478019 (+) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| RX142_RS02450 (RX142_02450) | - | 478324..479209 (-) | 886 | Protein_461 | IS256 family transposase | - |
| RX142_RS02455 (RX142_02455) | - | 479339..479983 (+) | 645 | WP_002289351.1 | IS6 family transposase | - |
| RX142_RS02460 (RX142_02460) | - | 480156..480470 (+) | 315 | WP_002403043.1 | hypothetical protein | - |
| RX142_RS02465 (RX142_02465) | cylR2 | 480808..481008 (-) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| RX142_RS02470 (RX142_02470) | cylL-L | 481412..481618 (+) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| RX142_RS02475 (RX142_02475) | cylL-S | 481652..481843 (+) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| RX142_RS02480 (RX142_02480) | - | 481904..484885 (+) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| RX142_RS02485 (RX142_02485) | - | 484897..485403 (+) | 507 | WP_316498892.1 | cysteine peptidase family C39 domain-containing protein | - |
| RX142_RS02490 (RX142_02490) | - | 485419..487041 (+) | 1623 | WP_263711767.1 | peptidase domain-containing ABC transporter | - |
| RX142_RS02495 (RX142_02495) | - | 487038..488276 (+) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| RX142_RS02500 (RX142_02500) | - | 488277..489260 (+) | 984 | WP_002368282.1 | site-2 protease family protein | - |
| RX142_RS02505 (RX142_02505) | - | 489613..490176 (+) | 564 | WP_002370925.1 | hypothetical protein | - |
| RX142_RS02510 (RX142_02510) | - | 490613..491080 (+) | 468 | WP_002370921.1 | hypothetical protein | - |
| RX142_RS02515 (RX142_02515) | - | 491158..491739 (+) | 582 | WP_002401490.1 | hypothetical protein | - |
| RX142_RS02520 (RX142_02520) | - | 491834..492040 (+) | 207 | WP_229017897.1 | S41 family peptidase | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=890117 RX142_RS02345 WP_002365911.1 458792..459250(+) (ssb) [Enterococcus faecalis strain ES-397]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=890117 RX142_RS02345 WP_002365911.1 458792..459250(+) (ssb) [Enterococcus faecalis strain ES-397]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |