Detailed information
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | RE395_RS16165 | Genome accession | NZ_CP133579 |
| Coordinates | 3498140..3498556 (-) | Length | 138 a.a. |
| NCBI ID | WP_071306344.1 | Uniprot ID | - |
| Organism | Stenotrophomonas geniculata strain G303 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3498140..3526484 | 3498140..3498556 | within | 0 |
Gene organization within MGE regions
Location: 3498140..3526484
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RE395_RS16165 | pilA | 3498140..3498556 (-) | 417 | WP_071306344.1 | pilin | Machinery gene |
| RE395_RS16170 | comP | 3498664..3499092 (-) | 429 | WP_071306345.1 | pilin | Machinery gene |
| RE395_RS16175 | pilC | 3499451..3500710 (+) | 1260 | WP_071306346.1 | type II secretion system F family protein | Machinery gene |
| RE395_RS16180 | - | 3500719..3501582 (+) | 864 | WP_419965228.1 | prepilin peptidase | - |
| RE395_RS16185 | coaE | 3501594..3502205 (+) | 612 | WP_313509574.1 | dephospho-CoA kinase | - |
| RE395_RS16190 | - | 3502366..3502752 (-) | 387 | WP_197654393.1 | hypothetical protein | - |
| RE395_RS16195 | - | 3503235..3504602 (-) | 1368 | WP_313509571.1 | HAMP domain-containing sensor histidine kinase | - |
| RE395_RS16200 | - | 3504565..3505242 (-) | 678 | WP_005410804.1 | response regulator transcription factor | - |
| RE395_RS16205 | - | 3505256..3505741 (-) | 486 | WP_099560236.1 | hypothetical protein | - |
| RE395_RS16210 | rimK | 3506022..3506900 (-) | 879 | WP_005410807.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| RE395_RS16215 | - | 3507032..3507454 (+) | 423 | WP_197601917.1 | thioesterase family protein | - |
| RE395_RS16220 | - | 3507564..3508745 (-) | 1182 | WP_313509568.1 | hypothetical protein | - |
| RE395_RS16225 | - | 3508852..3509718 (+) | 867 | WP_419965889.1 | PoNe immunity protein domain-containing protein | - |
| RE395_RS16230 | - | 3509720..3510124 (-) | 405 | WP_019336442.1 | DUF805 domain-containing protein | - |
| RE395_RS16235 | - | 3510419..3511156 (+) | 738 | WP_313509562.1 | hypothetical protein | - |
| RE395_RS16240 | - | 3511546..3511767 (-) | 222 | WP_010481480.1 | DUF2188 domain-containing protein | - |
| RE395_RS16245 | - | 3511914..3512384 (-) | 471 | WP_419965229.1 | ankyrin repeat domain-containing protein | - |
| RE395_RS16250 | traD | 3512381..3512746 (-) | 366 | WP_241873125.1 | conjugal transfer protein TraD | - |
| RE395_RS16255 | mobQ | 3513132..3514829 (+) | 1698 | WP_419965230.1 | MobQ family relaxase | - |
| RE395_RS16260 | - | 3514850..3515188 (-) | 339 | WP_134959420.1 | helix-turn-helix domain-containing protein | - |
| RE395_RS16265 | - | 3515299..3515622 (+) | 324 | WP_419965231.1 | hypothetical protein | - |
| RE395_RS16270 | - | 3515626..3516087 (+) | 462 | WP_419965232.1 | hypothetical protein | - |
| RE395_RS16275 | - | 3516611..3518056 (-) | 1446 | WP_285308899.1 | ATP-dependent nuclease | - |
| RE395_RS16280 | - | 3519175..3520419 (-) | 1245 | WP_419965233.1 | HlyD family secretion protein | - |
| RE395_RS16285 | - | 3520416..3522536 (-) | 2121 | WP_419965890.1 | peptidase domain-containing ABC transporter | - |
| RE395_RS16290 | - | 3522729..3523325 (-) | 597 | WP_419965234.1 | type II CAAX prenyl endopeptidase Rce1 family protein | - |
| RE395_RS16295 | - | 3523717..3524232 (-) | 516 | WP_419965235.1 | type II CAAX prenyl endopeptidase Rce1 family protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 14522.94 Da Isoelectric Point: 8.1045
>NTDB_id=875058 RE395_RS16165 WP_071306344.1 3498140..3498556(-) (pilA) [Stenotrophomonas geniculata strain G303]
MLKNRGFTLIELMIVVAIIAVLGAIALPAYQDYTVRARVSEALLLVSAAKVTVTENVNNINKLDATACAGVDDMGATTSN
VGSLTCTGKGVLTVVTTEIAGKVTLQLAPAYNPNEVIRWTCSRIAGPNKYVPAECRSP
MLKNRGFTLIELMIVVAIIAVLGAIALPAYQDYTVRARVSEALLLVSAAKVTVTENVNNINKLDATACAGVDDMGATTSN
VGSLTCTGKGVLTVVTTEIAGKVTLQLAPAYNPNEVIRWTCSRIAGPNKYVPAECRSP
Nucleotide
Download Length: 417 bp
>NTDB_id=875058 RE395_RS16165 WP_071306344.1 3498140..3498556(-) (pilA) [Stenotrophomonas geniculata strain G303]
ATGCTCAAAAACAGGGGATTTACTCTCATCGAACTGATGATCGTGGTCGCGATCATCGCTGTTCTGGGGGCCATCGCATT
GCCCGCGTATCAGGACTATACGGTGCGCGCCCGAGTTTCGGAGGCTCTTCTGCTGGTATCTGCGGCCAAAGTTACTGTCA
CTGAGAATGTAAACAATATAAATAAGTTGGACGCGACGGCCTGCGCGGGCGTTGACGATATGGGGGCGACGACGAGTAAT
GTCGGCTCGCTCACTTGCACGGGGAAAGGCGTGCTCACCGTGGTAACGACTGAGATTGCAGGGAAAGTGACGTTGCAGCT
TGCGCCCGCCTACAATCCGAATGAAGTCATCCGTTGGACCTGCTCACGAATTGCGGGGCCCAACAAGTATGTTCCAGCGG
AGTGCCGGTCTCCCTGA
ATGCTCAAAAACAGGGGATTTACTCTCATCGAACTGATGATCGTGGTCGCGATCATCGCTGTTCTGGGGGCCATCGCATT
GCCCGCGTATCAGGACTATACGGTGCGCGCCCGAGTTTCGGAGGCTCTTCTGCTGGTATCTGCGGCCAAAGTTACTGTCA
CTGAGAATGTAAACAATATAAATAAGTTGGACGCGACGGCCTGCGCGGGCGTTGACGATATGGGGGCGACGACGAGTAAT
GTCGGCTCGCTCACTTGCACGGGGAAAGGCGTGCTCACCGTGGTAACGACTGAGATTGCAGGGAAAGTGACGTTGCAGCT
TGCGCCCGCCTACAATCCGAATGAAGTCATCCGTTGGACCTGCTCACGAATTGCGGGGCCCAACAAGTATGTTCCAGCGG
AGTGCCGGTCTCCCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA | Ralstonia pseudosolanacearum GMI1000 |
43.827 |
100 |
0.514 |
| comP | Acinetobacter baylyi ADP1 |
44.966 |
100 |
0.486 |
| pilA2 | Legionella pneumophila str. Paris |
47.407 |
97.826 |
0.464 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
47.407 |
97.826 |
0.464 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
38.608 |
100 |
0.442 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
32.065 |
100 |
0.428 |
| pilE | Neisseria gonorrhoeae MS11 |
43.077 |
94.203 |
0.406 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
36.986 |
100 |
0.391 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
40.945 |
92.029 |
0.377 |