Detailed information NTG0086221

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: KI212_RS05735
• Genome accession: NZ_AP024589
• Coordinates: 1224463..1224774 (-)
• Length: 103 a.a.
• NCBI ID: WP_267952013.1
• Uniprot ID: -
• Organism: Staphylococcus auricularis strain JCM 2421
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1219463..1229774

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KI212_RS05705 (JCM2421_11720)	gcvPA	1220015..1221367 (-)	1353	WP_059107298.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
KI212_RS05710 (JCM2421_11730)	gcvT	1221387..1222478 (-)	1092	WP_059107297.1	glycine cleavage system aminomethyltransferase GcvT	-
KI212_RS05715 (JCM2421_11740)	-	1222659..1223165 (-)	507	WP_059107296.1	shikimate kinase	-
KI212_RS05720	-	1223339..1223731 (-)	393	WP_083498173.1	ComGF family competence protein	-
KI212_RS05725 (JCM2421_11780)	-	1223756..1224049 (-)	294	WP_059107294.1	hypothetical protein	-
KI212_RS05730 (JCM2421_11790)	comGD	1224036..1224473 (-)	438	WP_059107293.1	competence type IV pilus minor pilin ComGD	-
KI212_RS05735 (JCM2421_11800)	comGC	1224463..1224774 (-)	312	WP_267952013.1	competence type IV pilus major pilin ComGC	Machinery gene
KI212_RS05740 (JCM2421_11810)	comGB	1224858..1225931 (-)	1074	WP_059107292.1	competence type IV pilus assembly protein ComGB	-
KI212_RS05745	comGA	1225903..1226877 (-)	975	Protein_1147	competence type IV pilus ATPase ComGA	-
KI212_RS05750 (JCM2421_11840)	-	1226980..1227600 (-)	621	WP_059107291.1	MBL fold metallo-hydrolase	-
KI212_RS05755 (JCM2421_11850)	-	1227616..1227927 (-)	312	WP_059107290.1	MTH1187 family thiamine-binding protein	-
KI212_RS05760 (JCM2421_11860)	-	1227927..1228913 (-)	987	WP_059107289.1	ROK family glucokinase	-
KI212_RS05765 (JCM2421_11870)	-	1228914..1229114 (-)	201	WP_059107288.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11539.67 Da
• Isoelectric Point: 9.7109

>NTDB_id=86221 KI212_RS05735 WP_267952013.1 1224463..1224774(-) (comGC) [Staphylococcus auricularis strain JCM 2421]
MNIKKLRQKAFTLIEMLLVLLIISILLILIIPNIAKQSENIQAKGCDAQLKMVNSQIEAYTLKHDRKPNTIDDLVQDGFI
KENQKRCKSGAVIAIQNGEAHAT

Nucleotide

• Length: 312 bp

>NTDB_id=86221 KI212_RS05735 WP_267952013.1 1224463..1224774(-) (comGC) [Staphylococcus auricularis strain JCM 2421]
TTGAATATAAAAAAACTCAGACAAAAAGCTTTTACGTTGATCGAAATGTTACTTGTATTATTGATTATTAGTATTTTGCT
CATCCTCATAATCCCGAACATCGCGAAACAATCTGAAAACATACAAGCTAAAGGTTGTGATGCACAACTGAAAATGGTGA
ACAGTCAAATTGAAGCATATACGCTAAAACATGATAGAAAACCGAATACAATTGATGATTTAGTGCAAGATGGTTTTATT
AAAGAAAATCAAAAGAGATGTAAATCAGGTGCCGTGATTGCTATTCAAAACGGGGAAGCGCATGCTACTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	72.917	93.204	0.68
comGC	Staphylococcus aureus MW2	72.917	93.204	0.68
comYC	Streptococcus gordonii str. Challis substr. CH1	50	79.612	0.398
comGC/cglC	Streptococcus mitis NCTC 12261	47.059	82.524	0.388
comGC/cglC	Streptococcus mitis SK321	47.059	82.524	0.388
comGC	Bacillus subtilis subsp. subtilis str. 168	42.553	91.262	0.388
comYC	Streptococcus mutans UA159	47.561	79.612	0.379
comYC	Streptococcus suis isolate S10	47.561	79.612	0.379
comYC	Streptococcus mutans UA140	47.561	79.612	0.379
comGC/cglC	Streptococcus pneumoniae R6	45.882	82.524	0.379
comGC/cglC	Streptococcus pneumoniae D39	45.882	82.524	0.379
comGC/cglC	Streptococcus pneumoniae Rx1	45.882	82.524	0.379
comGC/cglC	Streptococcus pneumoniae TIGR4	45.882	82.524	0.379