Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WBM82_RS13210 Genome accession   NZ_CP147494
Coordinates   2495225..2495608 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain YT1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2490225..2500608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WBM82_RS13170 (WBM82_13215) sinI 2491158..2491331 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WBM82_RS13175 (WBM82_13220) sinR 2491365..2491700 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WBM82_RS13180 (WBM82_13225) tasA 2491793..2492578 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  WBM82_RS13185 (WBM82_13230) sipW 2492642..2493214 (-) 573 WP_072692741.1 signal peptidase I -
  WBM82_RS13190 (WBM82_13235) tapA 2493198..2493959 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  WBM82_RS13195 (WBM82_13240) yqzG 2494231..2494557 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WBM82_RS13200 (WBM82_13245) spoIIT 2494599..2494778 (-) 180 WP_029726723.1 YqzE family protein -
  WBM82_RS13205 (WBM82_13250) comGG 2494850..2495224 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  WBM82_RS13210 (WBM82_13255) comGF 2495225..2495608 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  WBM82_RS13215 (WBM82_13260) comGE 2495634..2495981 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  WBM82_RS13220 (WBM82_13265) comGD 2495965..2496396 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  WBM82_RS13225 (WBM82_13270) comGC 2496386..2496682 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  WBM82_RS13230 (WBM82_13275) comGB 2496696..2497733 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  WBM82_RS13235 (WBM82_13280) comGA 2497720..2498790 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WBM82_RS13240 (WBM82_13285) - 2499003..2499200 (-) 198 WP_029726717.1 hypothetical protein -
  WBM82_RS13245 (WBM82_13290) corA 2499202..2500155 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=859541 WBM82_RS13210 WP_029726721.1 2495225..2495608(-) (comGF) [Bacillus subtilis strain YT1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=859541 WBM82_RS13210 WP_029726721.1 2495225..2495608(-) (comGF) [Bacillus subtilis strain YT1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969