Detailed information NTG0859147

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: Q3V80_RS07615
• Genome accession: NZ_CP130515
• Coordinates: 1588534..1588845 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SA28-SX
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1583534..1593845

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Q3V80_RS07580	gcvPA	1584036..1585382 (-)	1347	WP_000019688.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
Q3V80_RS07585	gcvT	1585402..1586493 (-)	1092	WP_000093355.1	glycine cleavage system aminomethyltransferase GcvT	-
Q3V80_RS07590	-	1586652..1587176 (-)	525	WP_001015122.1	shikimate kinase	-
Q3V80_RS07595	-	1587166..1587312 (-)	147	WP_001789879.1	hypothetical protein	-
Q3V80_RS07600	comGF	1587409..1587906 (-)	498	WP_029697681.1	competence type IV pilus minor pilin ComGF	Machinery gene
Q3V80_RS07605	comGE	1587824..1588123 (-)	300	WP_217654599.1	competence protein ComGE	Machinery gene
Q3V80_RS07610	comGD	1588110..1588556 (-)	447	WP_075583651.1	competence type IV pilus minor pilin ComGD	Machinery gene
Q3V80_RS07615	comGC	1588534..1588845 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
Q3V80_RS07620	comGB	1588859..1589929 (-)	1071	WP_000776403.1	competence type IV pilus assembly protein ComGB	Machinery gene
Q3V80_RS07625	comGA	1589901..1590875 (-)	975	WP_000697215.1	competence type IV pilus ATPase ComGA	Machinery gene
Q3V80_RS07630	-	1590927..1591550 (-)	624	WP_001223006.1	MBL fold metallo-hydrolase	-
Q3V80_RS07635	-	1591547..1591876 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
Q3V80_RS07640	-	1591876..1592862 (-)	987	WP_000161315.1	ROK family glucokinase	-
Q3V80_RS07645	-	1592859..1593062 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=859147 Q3V80_RS07615 WP_000472256.1 1588534..1588845(-) (comGC) [Staphylococcus aureus strain SA28-SX]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=859147 Q3V80_RS07615 WP_000472256.1 1588534..1588845(-) (comGC) [Staphylococcus aureus strain SA28-SX]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369