NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	P3U48_RS06360	Genome accession	NZ_CP129355
Coordinates	1347822..1348145 (+)	Length	107 a.a.
NCBI ID	WP_015729165.1	Uniprot ID	-
Organism	Staphylococcus pseudintermedius strain Dog009_2
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1342822..1353145

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3U48_RS06335 (P3U48_06335)	-	1343196..1344347 (+)	1152	WP_015729170.1	SNF2-related protein	-
P3U48_RS06340 (P3U48_06340)	-	1344347..1345636 (+)	1290	WP_320409228.1	DUF3440 domain-containing protein	-
P3U48_RS06345 (P3U48_06345)	-	1345630..1346136 (+)	507	WP_320409356.1	ParB/RepB/Spo0J family partition protein	-
P3U48_RS06350 (P3U48_06350)	-	1346237..1346773 (+)	537	Protein_1236	ATPase, T2SS/T4P/T4SS family	-
P3U48_RS06355 (P3U48_06355)	comGB	1346742..1347809 (+)	1068	WP_014613821.1	competence type IV pilus assembly protein ComGB	-
P3U48_RS06360 (P3U48_06360)	comGC	1347822..1348145 (+)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
P3U48_RS06365 (P3U48_06365)	comGD	1348123..1348563 (+)	441	WP_063284397.1	competence type IV pilus minor pilin ComGD	-
P3U48_RS06370 (P3U48_06370)	-	1348668..1348868 (+)	201	WP_309256016.1	hypothetical protein	-
P3U48_RS06375 (P3U48_06375)	-	1348774..1349259 (+)	486	WP_080552896.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
P3U48_RS06380 (P3U48_06380)	-	1349423..1349950 (+)	528	WP_014613826.1	shikimate kinase	-
P3U48_RS06385 (P3U48_06385)	gcvT	1350108..1351199 (+)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
P3U48_RS06390 (P3U48_06390)	gcvPA	1351212..1352561 (+)	1350	WP_099997513.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 107 a.a. Molecular weight: 12027.26 Da Isoelectric Point: 9.0966

                                >NTDB_id=852670 P3U48_RS06360 WP_015729165.1 1347822..1348145(+) (comGC) [Staphylococcus pseudintermedius strain Dog009_2]

MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR

EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

Download Length: 324 bp

                                >NTDB_id=852670 P3U48_RS06360 WP_015729165.1 1347822..1348145(+) (comGC) [Staphylococcus pseudintermedius strain Dog009_2]

ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT

TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT

TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT

GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC

ATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374

Detailed information NTG0852670