Detailed information NTG0851380

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: LLD17_RS03000
• Genome accession: NZ_CP129182
• Coordinates: 446018..446407 (+)
• Length: 129 a.a.
• NCBI ID: WP_021165898.1
• Uniprot ID: A0A166Z4Y5
• Organism: Lactococcus cremoris strain D.1.7
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	446018..457627	446018..446407	within	0

Gene organization within MGE regions

Location: 446018..457627

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLD17_RS03000 (LLD17_03005)	ssbB	446018..446407 (+)	390	WP_021165898.1	single-stranded DNA-binding protein	Machinery gene
LLD17_RS03005 (LLD17_03010)	groES	446526..446810 (+)	285	WP_011675464.1	co-chaperone GroES	-
LLD17_RS03010 (LLD17_03015)	groL	446897..448525 (+)	1629	WP_021213999.1	chaperonin GroEL	-
LLD17_RS03015 (LLD17_03020)	-	448577..449389 (-)	813	WP_011675466.1	MBL fold metallo-hydrolase	-
LLD17_RS03020 (LLD17_03025)	-	449579..451006 (-)	1428	WP_011675468.1	cell wall metabolism sensor histidine kinase WalK	-
LLD17_RS03025 (LLD17_03030)	yycF	450999..451700 (-)	702	WP_003131580.1	response regulator YycF	-
LLD17_RS03030 (LLD17_03035)	tmk	451878..452513 (+)	636	WP_015082045.1	dTMP kinase	-
LLD17_RS03035 (LLD17_03040)	-	452646..453506 (+)	861	WP_011675470.1	DNA polymerase III subunit delta'	-
LLD17_RS03040 (LLD17_03045)	ricT	453556..454338 (+)	783	WP_011834464.1	stage 0 sporulation family protein	-
LLD17_RS03045 (LLD17_03050)	yabA	454331..454657 (+)	327	WP_011675472.1	DNA replication initiation control protein YabA	-
LLD17_RS03050 (LLD17_03055)	rsmI	454657..455532 (+)	876	WP_011834466.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-
LLD17_RS03055 (LLD17_03060)	-	455610..455801 (-)	192	WP_011675474.1	hypothetical protein	-
LLD17_RS03060 (LLD17_03065)	-	455876..456685 (-)	810	WP_014572051.1	ABC transporter permease	-
LLD17_RS03065 (LLD17_03070)	-	456698..457627 (-)	930	WP_081196491.1	ATP-binding cassette domain-containing protein	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14703.77 Da
• Isoelectric Point: 6.9865

>NTDB_id=851380 LLD17_RS03000 WP_021165898.1 446018..446407(+) (ssbB) [Lactococcus cremoris strain D.1.7]
MNKTMLIGRLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREADFISIILWGKSAETFVSYAKKGSLISVEGEIRTRN
YTDKNEQKHCITEILGLSYDLLESRATLALRESAVNFEELLLEADELPF

Nucleotide

• Length: 390 bp

>NTDB_id=851380 LLD17_RS03000 WP_021165898.1 446018..446407(+) (ssbB) [Lactococcus cremoris strain D.1.7]
ATGAATAAAACCATGTTGATTGGTCGTTTAACAAACGCACCTGAAATTTCGAAAACAACGAACAATAAATCTTATGTCCG
TGTGACTCTGGCAGTCAATCGCCGCTTCAAAAATGAAAAAGGAGAGCGAGAAGCAGACTTTATCTCGATAATTTTATGGG
GAAAATCAGCAGAAACATTCGTTTCCTATGCTAAAAAAGGAAGTCTTATTTCTGTAGAGGGAGAGATTAGAACTAGAAAT
TATACTGATAAAAATGAACAGAAACACTGTATTACAGAAATCTTAGGTTTGAGCTATGATTTATTGGAAAGTCGTGCGAC
TCTTGCCTTGAGAGAAAGCGCTGTAAATTTTGAGGAACTCTTACTTGAAGCTGATGAGCTCCCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-95)

3D structure

• AlphaFold DB: A0A166Z4Y5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Lactococcus lactis subsp. cremoris KW2	96.899	100	0.969
ssbB	Streptococcus sobrinus strain NIDR 6715-7	60	100	0.605
ssbA	Streptococcus mutans UA159	56.154	100	0.566
ssbB/cilA	Streptococcus pneumoniae TIGR4	56.154	100	0.566
ssbB/cilA	Streptococcus mitis SK321	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae R6	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae Rx1	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae D39	55.385	100	0.558
ssbB/cilA	Streptococcus mitis NCTC 12261	55.385	100	0.558
ssb	Latilactobacillus sakei subsp. sakei 23K	41.964	86.822	0.364