Detailed information NTG0833149

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QM319_RS07465
• Genome accession: NZ_CP125863
• Coordinates: 1576741..1577052 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 19-00012
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1571741..1582052

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QM319_RS07430 (QM319_07425)	gcvT	1572276..1573367 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
QM319_RS07435 (QM319_07430)	-	1573526..1574050 (-)	525	WP_001015120.1	shikimate kinase	-
QM319_RS07440 (QM319_07435)	-	1574040..1574186 (-)	147	WP_001789879.1	hypothetical protein	-
QM319_RS07445 (QM319_07440)	-	1574253..1575425 (-)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
QM319_RS07450 (QM319_07445)	comGF	1575616..1576113 (-)	498	WP_001825340.1	competence type IV pilus minor pilin ComGF	Machinery gene
QM319_RS07455 (QM319_07450)	comGE	1576031..1576330 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
QM319_RS07460 (QM319_07455)	comGD	1576317..1576763 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
QM319_RS07465 (QM319_07460)	comGC	1576741..1577052 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
QM319_RS07470 (QM319_07465)	comGB	1577066..1578136 (-)	1071	WP_000776425.1	competence type IV pilus assembly protein ComGB	Machinery gene
QM319_RS07475 (QM319_07470)	comGA	1578108..1579082 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
QM319_RS07480 (QM319_07475)	-	1579134..1579757 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
QM319_RS07485 (QM319_07480)	-	1579754..1580083 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
QM319_RS07490 (QM319_07485)	-	1580083..1581069 (-)	987	WP_000161315.1	ROK family glucokinase	-
QM319_RS07495 (QM319_07490)	-	1581066..1581269 (-)	204	WP_000087559.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=833149 QM319_RS07465 WP_000472256.1 1576741..1577052(-) (comGC) [Staphylococcus aureus strain 19-00012]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=833149 QM319_RS07465 WP_000472256.1 1576741..1577052(-) (comGC) [Staphylococcus aureus strain 19-00012]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369