Detailed information NTG0818318

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: R4714_RS04300
• Genome accession: NZ_CP137099
• Coordinates: 797706..797972 (-)
• Length: 88 a.a.
• NCBI ID: WP_000962022.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain 20824-4
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 792706..802972

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4714_RS04255	rnpA	792725..793096 (-)	372	WP_000739246.1	ribonuclease P protein component	-
R4714_RS04260	-	793113..793244 (-)	132	WP_000768904.1	hypothetical protein	-
R4714_RS04265	-	793245..794435 (-)	1191	WP_000167766.1	acetate kinase	-
R4714_RS04270	comGH	794486..795439 (-)	954	WP_000345130.1	class I SAM-dependent methyltransferase	Machinery gene
R4714_RS04275	-	795500..796094 (-)	595	Protein_810	class I SAM-dependent methyltransferase	-
R4714_RS04280	comGG/cglG	796250..796642 (-)	393	WP_219576921.1	competence type IV pilus minor pilin ComGG	Machinery gene
R4714_RS04285	comGF/cglF	796620..797081 (-)	462	WP_000250539.1	competence type IV pilus minor pilin ComGF	Machinery gene
R4714_RS04290	comGE/cglE	797044..797346 (-)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
R4714_RS04295	comGD/cglD	797309..797713 (-)	405	WP_000588030.1	competence type IV pilus minor pilin ComGD	Machinery gene
R4714_RS04300	comGC/cglC	797706..797972 (-)	267	WP_000962022.1	competence type IV pilus major pilin ComGC	Machinery gene
R4714_RS04305	-	797974..798231 (-)	258	WP_000698512.1	hypothetical protein	-
R4714_RS04310	-	798502..799458 (-)	957	WP_057524567.1	N-acetylmuramoyl-L-alanine amidase family protein	-
R4714_RS04315	-	799462..799794 (-)	333	WP_317769868.1	phage holin	-
R4714_RS04320	-	799798..800097 (-)	300	WP_001811580.1	hypothetical protein	-
R4714_RS04325	-	800106..800456 (-)	351	WP_000852245.1	hypothetical protein	-
R4714_RS04330	-	800459..800662 (-)	204	WP_001091112.1	hypothetical protein	-
R4714_RS04335	-	800643..800759 (-)	117	WP_001063633.1	hypothetical protein	-

Sequence

Protein

• Length: 88 a.a.
• Molecular weight: 9788.23 Da
• Isoelectric Point: 6.3192

>NTDB_id=818318 R4714_RS04300 WP_000962022.1 797706..797972(-) (comGC/cglC) [Streptococcus pneumoniae strain 20824-4]
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLDKNEDATLSKLQGDGRITEEQVKAYNEYYTKNG
GANRKVND

Nucleotide

• Length: 267 bp

>NTDB_id=818318 R4714_RS04300 WP_000962022.1 797706..797972(-) (comGC/cglC) [Streptococcus pneumoniae strain 20824-4]
ATGTTAGTAGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGATAAAAATGAAGATGCTA
CTCTGAGCAAGTTACAAGGAGATGGGCGCATCACGGAAGAACAGGTTAAAGCTTATAATGAATACTATACTAAAAATGGA
GGGGCAAATCGTAAAGTCAATGATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae D39	90.909	100	0.909
comGC/cglC	Streptococcus pneumoniae R6	90.909	100	0.909
comGC/cglC	Streptococcus pneumoniae TIGR4	90.909	100	0.909
comGC/cglC	Streptococcus pneumoniae Rx1	90.909	100	0.909
comGC/cglC	Streptococcus mitis SK321	94.595	84.091	0.795
comGC	Streptococcus gordonii str. Challis substr. CH1	66.667	98.864	0.659
comGC/cglC	Streptococcus mitis NCTC 12261	90.625	72.727	0.659
comGC	Streptococcus suis isolate S10	65.278	81.818	0.534
comGC	Streptococcus mutans UA140	60	79.545	0.477
comGC	Streptococcus mutans UA159	60	79.545	0.477
comGC	Lactococcus lactis subsp. cremoris KW2	53.333	85.227	0.455