Detailed information NTG0812871

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QA712_RS06885
• Genome accession: NZ_CP121539
• Coordinates: 1250909..1251178 (-)
• Length: 89 a.a.
• NCBI ID: WP_021721869.1
• Uniprot ID: A0A552Z108
• Organism: Lactococcus lactis strain MA5
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1245909..1256178

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QA712_RS06845 (QA712_06845)	-	1246445..1247254 (-)	810	WP_014570791.1	metal ABC transporter permease	-
QA712_RS06850 (QA712_06850)	-	1247247..1247984 (-)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
QA712_RS06855 (QA712_06855)	-	1248161..1249003 (-)	843	WP_311920327.1	metal ABC transporter substrate-binding protein	-
QA712_RS06860 (QA712_06860)	-	1249000..1249437 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
QA712_RS06865 (QA712_06865)	comGG	1249518..1249802 (-)	285	WP_311802844.1	competence type IV pilus minor pilin ComGG	Machinery gene
QA712_RS06870 (QA712_06870)	comGF	1249841..1250287 (-)	447	WP_195935889.1	competence type IV pilus minor pilin ComGF	Machinery gene
QA712_RS06875 (QA712_06875)	comGE	1250250..1250546 (-)	297	WP_332529356.1	competence type IV pilus minor pilin ComGE	Machinery gene
QA712_RS06880 (QA712_06880)	comGD	1250518..1250949 (-)	432	WP_195935890.1	competence type IV pilus minor pilin ComGD	Machinery gene
QA712_RS06885 (QA712_06885)	comGC	1250909..1251178 (-)	270	WP_021721869.1	competence type IV pilus major pilin ComGC	Machinery gene
QA712_RS06890 (QA712_06890)	comGB	1251306..1252380 (-)	1075	Protein_1223	competence type IV pilus assembly protein ComGB	-
QA712_RS06895 (QA712_06895)	comGA	1252274..1253212 (-)	939	WP_195935891.1	competence type IV pilus ATPase ComGA	Machinery gene
QA712_RS06900 (QA712_06900)	-	1253481..1253663 (-)	183	WP_047206975.1	hypothetical protein	-
QA712_RS06905 (QA712_06905)	-	1253654..1254244 (-)	591	WP_052772651.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10127.55 Da
• Isoelectric Point: 4.2950

>NTDB_id=812871 QA712_RS06885 WP_021721869.1 1250909..1251178(-) (comGC) [Lactococcus lactis strain MA5]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPTLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=812871 QA712_RS06885 WP_021721869.1 1250909..1251178(-) (comGC) [Lactococcus lactis strain MA5]
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCCCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGACTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A552Z108

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	88	84.27	0.742
comYC	Streptococcus gordonii str. Challis substr. CH1	58.824	95.506	0.562
comGC/cglC	Streptococcus pneumoniae Rx1	53.933	100	0.539
comGC/cglC	Streptococcus pneumoniae D39	53.933	100	0.539
comGC/cglC	Streptococcus pneumoniae R6	53.933	100	0.539
comGC/cglC	Streptococcus pneumoniae TIGR4	53.933	100	0.539
comYC	Streptococcus suis isolate S10	60.274	82.022	0.494
comGC/cglC	Streptococcus mitis SK321	53.947	85.393	0.461
comYC	Streptococcus mutans UA140	53.425	82.022	0.438
comYC	Streptococcus mutans UA159	53.425	82.022	0.438
comGC/cglC	Streptococcus mitis NCTC 12261	56.25	71.91	0.404