Detailed information NTG0809320

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: LLHP_RS02270
• Genome accession: NZ_CP120921
• Coordinates: 445891..446280 (+)
• Length: 129 a.a.
• NCBI ID: WP_021165898.1
• Uniprot ID: A0A166Z4Y5
• Organism: Lactococcus cremoris subsp. cremoris HP
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	445891..457499	445891..446280	within	0

Gene organization within MGE regions

Location: 445891..457499

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLHP_RS02270 (LLHP_02285)	ssbB	445891..446280 (+)	390	WP_021165898.1	single-stranded DNA-binding protein	Machinery gene
LLHP_RS02275 (LLHP_02290)	groES	446399..446683 (+)	285	WP_011675464.1	co-chaperone GroES	-
LLHP_RS02280 (LLHP_02295)	groL	446770..448398 (+)	1629	WP_032950921.1	chaperonin GroEL	-
LLHP_RS02285 (LLHP_02300)	-	448450..449262 (-)	813	WP_011675466.1	MBL fold metallo-hydrolase	-
LLHP_RS02290 (LLHP_02305)	-	449452..450879 (-)	1428	WP_011675468.1	cell wall metabolism sensor histidine kinase WalK	-
LLHP_RS02295 (LLHP_02310)	yycF	450872..451573 (-)	702	WP_003131580.1	response regulator YycF	-
LLHP_RS02300 (LLHP_02315)	tmk	451751..452386 (+)	636	WP_015082045.1	dTMP kinase	-
LLHP_RS02305 (LLHP_02320)	-	452518..453378 (+)	861	WP_011675470.1	DNA polymerase III subunit delta'	-
LLHP_RS02310 (LLHP_02325)	ricT	453428..454210 (+)	783	WP_011834464.1	stage 0 sporulation family protein	-
LLHP_RS02315 (LLHP_02330)	yabA	454203..454529 (+)	327	WP_011675472.1	DNA replication initiation control protein YabA	-
LLHP_RS02320 (LLHP_02335)	rsmI	454529..455404 (+)	876	WP_032950912.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-
LLHP_RS02325 (LLHP_02340)	-	455482..455673 (-)	192	WP_032950911.1	hypothetical protein	-
LLHP_RS02330 (LLHP_02345)	-	455748..456557 (-)	810	WP_014572051.1	ABC transporter permease	-
LLHP_RS02335 (LLHP_02350)	-	456570..457499 (-)	930	WP_011675476.1	daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14703.77 Da
• Isoelectric Point: 6.9865

>NTDB_id=809320 LLHP_RS02270 WP_021165898.1 445891..446280(+) (ssbB) [Lactococcus cremoris subsp. cremoris HP]
MNKTMLIGRLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREADFISIILWGKSAETFVSYAKKGSLISVEGEIRTRN
YTDKNEQKHCITEILGLSYDLLESRATLALRESAVNFEELLLEADELPF

Nucleotide

• Length: 390 bp

>NTDB_id=809320 LLHP_RS02270 WP_021165898.1 445891..446280(+) (ssbB) [Lactococcus cremoris subsp. cremoris HP]
ATGAATAAAACCATGTTGATTGGTCGTTTAACAAACGCACCTGAAATTTCGAAAACAACGAACAATAAATCTTATGTCCG
TGTGACTCTGGCAGTCAATCGCCGCTTCAAAAATGAAAAAGGAGAGCGAGAAGCAGACTTTATCTCGATAATTTTATGGG
GAAAATCAGCAGAAACATTCGTTTCCTATGCTAAAAAAGGAAGTCTTATTTCTGTAGAGGGAGAGATTAGAACTAGAAAT
TATACTGATAAAAATGAACAGAAACACTGTATTACAGAAATCTTAGGTTTGAGCTATGATTTATTGGAAAGTCGTGCGAC
TCTTGCCTTGAGAGAAAGCGCTGTAAATTTTGAGGAACTCTTACTTGAAGCTGATGAGCTCCCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-95)

3D structure

• AlphaFold DB: A0A166Z4Y5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Lactococcus lactis subsp. cremoris KW2	96.899	100	0.969
ssbB	Streptococcus sobrinus strain NIDR 6715-7	60	100	0.605
ssbA	Streptococcus mutans UA159	56.154	100	0.566
ssbB/cilA	Streptococcus pneumoniae TIGR4	56.154	100	0.566
ssbB/cilA	Streptococcus mitis SK321	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae R6	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae Rx1	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae D39	55.385	100	0.558
ssbB/cilA	Streptococcus mitis NCTC 12261	55.385	100	0.558
ssb	Latilactobacillus sakei subsp. sakei 23K	41.964	86.822	0.364