Detailed information NTG0800824

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3K39_RS06745
• Genome accession: NZ_CP119717
• Coordinates: 1399467..1399790 (+)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain CUVET18-1255
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1394467..1404790

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3K39_RS06715 (P3K39_06685)	-	1395144..1395347 (+)	204	WP_014613816.1	YqgQ family protein	-
P3K39_RS06720 (P3K39_06690)	-	1395344..1396330 (+)	987	WP_014613817.1	ROK family glucokinase	-
P3K39_RS06725 (P3K39_06695)	-	1396331..1396642 (+)	312	WP_014613818.1	MTH1187 family thiamine-binding protein	-
P3K39_RS06730 (P3K39_06700)	-	1396655..1397284 (+)	630	WP_096535719.1	MBL fold metallo-hydrolase	-
P3K39_RS06735 (P3K39_06705)	comGA	1397444..1398418 (+)	975	WP_014613820.1	competence type IV pilus ATPase ComGA	Machinery gene
P3K39_RS06740 (P3K39_06710)	comGB	1398387..1399454 (+)	1068	WP_015729166.1	competence type IV pilus assembly protein ComGB	-
P3K39_RS06745 (P3K39_06715)	comGC	1399467..1399790 (+)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
P3K39_RS06750 (P3K39_06720)	comGD	1399768..1400208 (+)	441	WP_015729164.1	competence type IV pilus minor pilin ComGD	-
P3K39_RS06755 (P3K39_06725)	-	1400280..1400513 (+)	234	WP_041614926.1	hypothetical protein	-
P3K39_RS06760 (P3K39_06730)	-	1400419..1400904 (+)	486	WP_080552896.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
P3K39_RS06765 (P3K39_06735)	-	1401068..1401595 (+)	528	WP_140241608.1	shikimate kinase	-
P3K39_RS06770 (P3K39_06740)	gcvT	1401753..1402844 (+)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
P3K39_RS06775 (P3K39_06745)	gcvPA	1402857..1404206 (+)	1350	WP_140241609.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=800824 P3K39_RS06745 WP_015729165.1 1399467..1399790(+) (comGC) [Staphylococcus pseudintermedius strain CUVET18-1255]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=800824 P3K39_RS06745 WP_015729165.1 1399467..1399790(+) (comGC) [Staphylococcus pseudintermedius strain CUVET18-1255]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374