NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	PYW40_RS06460	Genome accession	NZ_CP118979
Coordinates	1324953..1325273 (+)	Length	106 a.a.
NCBI ID	WP_057504819.1	Uniprot ID	-
Organism	Staphylococcus haemolyticus strain DSM 20263
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1319953..1330273

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYW40_RS06430	-	1320740..1320943 (+)	204	WP_011275664.1	YqgQ family protein	-
PYW40_RS06435	-	1320940..1321926 (+)	987	WP_037558191.1	ROK family glucokinase	-
PYW40_RS06440	-	1321926..1322249 (+)	324	WP_011275666.1	MTH1187 family thiamine-binding protein	-
PYW40_RS06445	-	1322251..1322877 (+)	627	WP_011275667.1	MBL fold metallo-hydrolase	-
PYW40_RS06450	comGA	1322929..1323903 (+)	975	WP_011275668.1	competence type IV pilus ATPase ComGA	Machinery gene
PYW40_RS06455	comGB	1323875..1324939 (+)	1065	WP_037558195.1	competence type IV pilus assembly protein ComGB	-
PYW40_RS06460	comGC	1324953..1325273 (+)	321	WP_057504819.1	competence type IV pilus major pilin ComGC	Machinery gene
PYW40_RS06465	comGD	1325338..1325706 (+)	369	WP_123955564.1	competence type IV pilus minor pilin ComGD	-
PYW40_RS06470	-	1325687..1325986 (+)	300	WP_037558199.1	hypothetical protein	-
PYW40_RS12625	-	1325925..1326395 (+)	471	WP_046464809.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
PYW40_RS06475	-	1326555..1327073 (+)	519	WP_037558203.1	shikimate kinase	-
PYW40_RS06480	gcvT	1327262..1328353 (+)	1092	WP_011275675.1	glycine cleavage system aminomethyltransferase GcvT	-
PYW40_RS06485	gcvPA	1328370..1329722 (+)	1353	WP_037558205.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 106 a.a. Molecular weight: 11853.96 Da Isoelectric Point: 9.2003

                                >NTDB_id=797117 PYW40_RS06460 WP_057504819.1 1324953..1325273(+) (comGC) [Staphylococcus haemolyticus strain DSM 20263]

MKNHFKNLKKLKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHIQSTGCEAQVKMINSQIEAYTLKHNRTPSNINDLIND

GLIKEEQKQCRSGETITISNGEAIAN

Nucleotide

Download Length: 321 bp

                                >NTDB_id=797117 PYW40_RS06460 WP_057504819.1 1324953..1325273(+) (comGC) [Staphylococcus haemolyticus strain DSM 20263]

ATGAAGAATCACTTTAAAAATTTAAAAAAGTTAAAAGCCTTTACTCTAATAGAAATGTTATTAGTATTACTAATTATCAG

CGTATTACTAATATTAATTATTCCAAACATTGCAAAACAAACAGCTCATATCCAGTCCACAGGTTGTGAAGCTCAAGTCA

AAATGATAAATAGTCAAATAGAAGCATATACATTAAAACATAATCGAACACCTTCTAATATAAATGATCTTATAAATGAT

GGCCTTATAAAAGAAGAACAAAAACAATGCAGATCGGGAGAAACAATTACAATATCTAATGGTGAGGCTATTGCGAACTA

G

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-33)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	84.314	96.226	0.811
comGC	Staphylococcus aureus N315	84.314	96.226	0.811
comYC	Streptococcus gordonii str. Challis substr. CH1	42.991	100	0.434
comGC/cglC	Streptococcus mitis SK321	50.617	76.415	0.387
comGC/cglC	Streptococcus mitis NCTC 12261	50.617	76.415	0.387
comGC/cglC	Streptococcus pneumoniae R6	49.383	76.415	0.377
comGC/cglC	Streptococcus pneumoniae TIGR4	49.383	76.415	0.377
comGC/cglC	Streptococcus pneumoniae Rx1	49.383	76.415	0.377
comGC/cglC	Streptococcus pneumoniae D39	49.383	76.415	0.377
comYC	Streptococcus mutans UA140	50	73.585	0.368
comYC	Streptococcus mutans UA159	50	73.585	0.368

Detailed information NTG0797117