Detailed information NTG0795827

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PYH69_RS07855
• Genome accession: NZ_CP118848
• Coordinates: 1586386..1586703 (-)
• Length: 105 a.a.
• NCBI ID: WP_070045385.1
• Uniprot ID: A0AAX3W128
• Organism: Mammaliicoccus lentus strain 7048
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1581386..1591703

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYH69_RS07825 (PYH69_07825)	gcvPA	1581930..1583273 (-)	1344	WP_017000245.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
PYH69_RS07830 (PYH69_07830)	gcvT	1583285..1584373 (-)	1089	WP_017000244.1	glycine cleavage system aminomethyltransferase GcvT	-
PYH69_RS07835 (PYH69_07835)	-	1584536..1585054 (-)	519	WP_017000243.1	shikimate kinase	-
PYH69_RS07840 (PYH69_07840)	comGF	1585290..1585685 (-)	396	WP_237687866.1	competence type IV pilus minor pilin ComGF	-
PYH69_RS07845 (PYH69_07845)	comGE	1585699..1585974 (-)	276	WP_017000240.1	competence type IV pilus minor pilin ComGE	-
PYH69_RS07850 (PYH69_07850)	comGD	1585958..1586386 (-)	429	WP_017000239.1	competence type IV pilus minor pilin ComGD	-
PYH69_RS07855 (PYH69_07855)	comGC	1586386..1586703 (-)	318	WP_070045385.1	competence type IV pilus major pilin ComGC	Machinery gene
PYH69_RS07860 (PYH69_07860)	comGB	1586717..1587754 (-)	1038	WP_064211062.1	competence type IV pilus assembly protein ComGB	-
PYH69_RS07865 (PYH69_07865)	comGA	1587754..1588650 (-)	897	WP_017000235.1	competence type IV pilus ATPase ComGA	Machinery gene
PYH69_RS07870 (PYH69_07870)	-	1588803..1589051 (+)	249	WP_017000234.1	DUF2626 family protein	-
PYH69_RS07875 (PYH69_07875)	-	1589116..1589748 (-)	633	WP_017000233.1	MBL fold metallo-hydrolase	-
PYH69_RS07880 (PYH69_07880)	-	1589846..1590085 (+)	240	WP_282861669.1	DUF2759 domain-containing protein	-
PYH69_RS07885 (PYH69_07885)	-	1590208..1591560 (-)	1353	WP_282861670.1	IS1182 family transposase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11590.66 Da
• Isoelectric Point: 7.8266

>NTDB_id=795827 PYH69_RS07855 WP_070045385.1 1586386..1586703(-) (comGC) [Mammaliicoccus lentus strain 7048]
MKNIKFFKKEEGFTLIEMLIVLLIISILLIIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLVSDG
FIKENQLTCKSGQNIVLNNGEVVAQ

Nucleotide

• Length: 318 bp

>NTDB_id=795827 PYH69_RS07855 WP_070045385.1 1586386..1586703(-) (comGC) [Mammaliicoccus lentus strain 7048]
ATGAAAAATATAAAGTTTTTTAAAAAAGAAGAAGGCTTCACGTTGATTGAGATGTTAATCGTATTATTAATTATAAGTAT
TTTACTTATAATTATAATCCCTAACATAAGCAAGCAGTCTGAAACCGTGAAAAGTACTGGTTGTCAGGCACAAGTTAAAA
TGGTTGCTGGCCAAGTAGAAGCATATACATTAAAACACGATGCTAAGCCAAATTCAATTAATGATTTAGTAAGTGATGGG
TTCATAAAAGAGAATCAATTGACTTGTAAATCTGGTCAGAACATTGTTTTAAATAACGGAGAAGTAGTAGCTCAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	66.337	96.19	0.638
comGC	Staphylococcus aureus N315	66.337	96.19	0.638
comGC	Bacillus subtilis subsp. subtilis str. 168	46.237	88.571	0.41
comGC/cglC	Streptococcus mitis NCTC 12261	40.952	100	0.41
comGC/cglC	Streptococcus mitis SK321	43.299	92.381	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae TIGR4	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae Rx1	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae D39	44.828	82.857	0.371
comYC	Streptococcus mutans UA159	50.649	73.333	0.371
comYC	Streptococcus mutans UA140	50.649	73.333	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	78.095	0.362