Detailed information NTG0795761

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PYH50_RS06305
• Genome accession: NZ_CP118837
• Coordinates: 1230785..1231102 (+)
• Length: 105 a.a.
• NCBI ID: WP_070045385.1
• Uniprot ID: A0AAX3W128
• Organism: Mammaliicoccus lentus strain 7050
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1225785..1236102

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYH50_RS06265 (PYH50_06265)	-	1225909..1226100 (+)	192	WP_017000229.1	YqgQ family protein	-
PYH50_RS06270 (PYH50_06270)	-	1226097..1227068 (+)	972	WP_239724182.1	ROK family glucokinase	-
PYH50_RS06275 (PYH50_06275)	-	1227068..1227382 (+)	315	WP_017000231.1	MTH1187 family thiamine-binding protein	-
PYH50_RS06280 (PYH50_06280)	-	1227412..1227651 (-)	240	WP_017000232.1	DUF2759 domain-containing protein	-
PYH50_RS06285 (PYH50_06285)	-	1227749..1228381 (+)	633	WP_017000233.1	MBL fold metallo-hydrolase	-
PYH50_RS06290 (PYH50_06290)	-	1228446..1228694 (-)	249	WP_017000234.1	DUF2626 family protein	-
PYH50_RS06295 (PYH50_06295)	comGA	1228847..1229743 (+)	897	WP_135031058.1	competence type IV pilus ATPase ComGA	Machinery gene
PYH50_RS06300 (PYH50_06300)	comGB	1229740..1230780 (+)	1041	WP_239724184.1	competence type IV pilus assembly protein ComGB	-
PYH50_RS06305 (PYH50_06305)	comGC	1230785..1231102 (+)	318	WP_070045385.1	competence type IV pilus major pilin ComGC	Machinery gene
PYH50_RS06310 (PYH50_06310)	comGD	1231102..1231530 (+)	429	WP_017000239.1	competence type IV pilus minor pilin ComGD	-
PYH50_RS06315 (PYH50_06315)	comGE	1231514..1231789 (+)	276	WP_017000240.1	competence type IV pilus minor pilin ComGE	-
PYH50_RS06320 (PYH50_06320)	comGF	1231803..1232198 (+)	396	WP_239724188.1	competence type IV pilus minor pilin ComGF	-
PYH50_RS06325 (PYH50_06325)	-	1232434..1232952 (+)	519	WP_064205405.1	shikimate kinase	-
PYH50_RS06330 (PYH50_06330)	gcvT	1233115..1234203 (+)	1089	WP_103269518.1	glycine cleavage system aminomethyltransferase GcvT	-
PYH50_RS06335 (PYH50_06335)	gcvPA	1234215..1235558 (+)	1344	WP_103269519.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11590.66 Da
• Isoelectric Point: 7.8266

>NTDB_id=795761 PYH50_RS06305 WP_070045385.1 1230785..1231102(+) (comGC) [Mammaliicoccus lentus strain 7050]
MKNIKFFKKEEGFTLIEMLIVLLIISILLIIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLVSDG
FIKENQLTCKSGQNIVLNNGEVVAQ

Nucleotide

• Length: 318 bp

>NTDB_id=795761 PYH50_RS06305 WP_070045385.1 1230785..1231102(+) (comGC) [Mammaliicoccus lentus strain 7050]
ATGAAAAATATAAAGTTTTTTAAAAAAGAAGAAGGCTTCACGTTGATTGAGATGTTAATCGTATTATTAATTATAAGTAT
TTTACTTATAATTATAATCCCTAACATAAGCAAGCAGTCTGAAACCGTGAAAAGTACTGGTTGTCAGGCACAAGTTAAAA
TGGTTGCTGGCCAAGTAGAAGCATATACATTAAAACACGATGCTAAGCCAAATTCAATTAATGATTTAGTAAGTGATGGG
TTCATAAAAGAGAATCAATTGACTTGTAAATCTGGTCAGAACATTGTTTTAAATAACGGAGAAGTAGTAGCTCAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	66.337	96.19	0.638
comGC	Staphylococcus aureus N315	66.337	96.19	0.638
comGC	Bacillus subtilis subsp. subtilis str. 168	46.237	88.571	0.41
comGC/cglC	Streptococcus mitis NCTC 12261	40.952	100	0.41
comGC/cglC	Streptococcus mitis SK321	43.299	92.381	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae TIGR4	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae Rx1	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae D39	44.828	82.857	0.371
comYC	Streptococcus mutans UA159	50.649	73.333	0.371
comYC	Streptococcus mutans UA140	50.649	73.333	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	78.095	0.362