Detailed information NTG0795390

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PYH68_RS07010
• Genome accession: NZ_CP118807
• Coordinates: 1451063..1451380 (+)
• Length: 105 a.a.
• NCBI ID: WP_029377192.1
• Uniprot ID: -
• Organism: Staphylococcus xylosus strain 7064
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1446063..1456380

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYH68_RS06980 (PYH68_06970)	-	1446415..1446615 (+)	201	WP_107542787.1	YqgQ family protein	-
PYH68_RS06985 (PYH68_06975)	-	1446997..1447983 (+)	987	WP_029377187.1	glucokinase	-
PYH68_RS06990 (PYH68_06980)	-	1447983..1448306 (+)	324	WP_042362616.1	MTH1187 family thiamine-binding protein	-
PYH68_RS06995 (PYH68_06985)	-	1448308..1448931 (+)	624	WP_042362617.1	MBL fold metallo-hydrolase	-
PYH68_RS07000 (PYH68_06990)	comGA	1449030..1450004 (+)	975	WP_107543212.1	competence type IV pilus ATPase ComGA	Machinery gene
PYH68_RS07005 (PYH68_06995)	comGB	1449976..1451043 (+)	1068	WP_107543211.1	competence type IV pilus assembly protein ComGB	-
PYH68_RS07010 (PYH68_07000)	comGC	1451063..1451380 (+)	318	WP_029377192.1	competence type IV pilus major pilin ComGC	Machinery gene
PYH68_RS07015 (PYH68_07005)	comGD	1451361..1451804 (+)	444	WP_234108761.1	competence type IV pilus minor pilin ComGD	-
PYH68_RS07020 (PYH68_07010)	-	1451791..1452090 (+)	300	WP_107543122.1	hypothetical protein	-
PYH68_RS07025 (PYH68_07015)	comGF	1452074..1452505 (+)	432	WP_326001449.1	competence type IV pilus minor pilin ComGF	-
PYH68_RS07030 (PYH68_07020)	-	1452670..1453185 (+)	516	WP_171031808.1	shikimate kinase	-
PYH68_RS07035 (PYH68_07025)	gcvT	1453373..1454464 (+)	1092	WP_326030877.1	glycine cleavage system aminomethyltransferase GcvT	-
PYH68_RS07040 (PYH68_07030)	gcvPA	1454482..1455834 (+)	1353	WP_042362625.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11788.86 Da
• Isoelectric Point: 8.4952

>NTDB_id=795390 PYH68_RS07010 WP_029377192.1 1451063..1451380(+) (comGC) [Staphylococcus xylosus strain 7064]
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=795390 PYH68_RS07010 WP_029377192.1 1451063..1451380(+) (comGC) [Staphylococcus xylosus strain 7064]
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGCTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGCAAGTCAGGCGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	70.297	96.19	0.676
comGC	Staphylococcus aureus MW2	70.297	96.19	0.676
comYC	Streptococcus gordonii str. Challis substr. CH1	46.296	100	0.476
comGC/cglC	Streptococcus pneumoniae D39	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae R6	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	39.623	100	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	40	100	0.4
comGC/cglC	Streptococcus mitis SK321	41.667	91.429	0.381
comGC	Bacillus subtilis subsp. subtilis str. 168	41.489	89.524	0.371
comYC	Streptococcus mutans UA140	49.351	73.333	0.362
comYC	Streptococcus mutans UA159	49.351	73.333	0.362