Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | PWP91_RS12610 | Genome accession | NZ_CP118738 |
| Coordinates | 2500696..2500965 (-) | Length | 89 a.a. |
| NCBI ID | WP_023349160.1 | Uniprot ID | A0AB35KDE0 |
| Organism | Lactococcus lactis strain P-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2497034..2542099 | 2500696..2500965 | within | 0 |
Gene organization within MGE regions
Location: 2497034..2542099
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWP91_RS12575 (PWP91_12575) | - | 2497034..2497771 (-) | 738 | WP_058211243.1 | metal ABC transporter ATP-binding protein | - |
| PWP91_RS12580 (PWP91_12580) | - | 2497948..2498790 (-) | 843 | WP_015427160.1 | metal ABC transporter substrate-binding protein | - |
| PWP91_RS12585 (PWP91_12585) | - | 2498787..2499224 (-) | 438 | WP_274998612.1 | zinc-dependent MarR family transcriptional regulator | - |
| PWP91_RS12590 (PWP91_12590) | comGG | 2499305..2499589 (-) | 285 | WP_017865155.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| PWP91_RS12595 (PWP91_12595) | comGF | 2499628..2500074 (-) | 447 | WP_032948129.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| PWP91_RS12600 (PWP91_12600) | comGE | 2500037..2500333 (-) | 297 | WP_250354455.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| PWP91_RS12605 (PWP91_12605) | comGD | 2500305..2500736 (-) | 432 | WP_012898621.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| PWP91_RS12610 (PWP91_12610) | comGC | 2500696..2500965 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PWP91_RS12620 (PWP91_12620) | - | 2501462..2501662 (-) | 201 | WP_058203534.1 | cold-shock protein | - |
| PWP91_RS12625 (PWP91_12625) | - | 2502719..2502862 (-) | 144 | WP_014573124.1 | hypothetical protein | - |
| PWP91_RS12630 (PWP91_12630) | - | 2502938..2504410 (-) | 1473 | WP_274998613.1 | ATP-binding protein | - |
| PWP91_RS12635 (PWP91_12635) | - | 2504550..2504828 (-) | 279 | WP_274998614.1 | hypothetical protein | - |
| PWP91_RS12640 (PWP91_12640) | - | 2504909..2506192 (-) | 1284 | WP_274998615.1 | LysM peptidoglycan-binding domain-containing protein | - |
| PWP91_RS12645 (PWP91_12645) | - | 2506189..2506413 (-) | 225 | WP_274998616.1 | phage holin | - |
| PWP91_RS12650 (PWP91_12650) | - | 2506426..2506785 (-) | 360 | WP_274998617.1 | hypothetical protein | - |
| PWP91_RS12655 (PWP91_12655) | - | 2506803..2507903 (-) | 1101 | WP_274998618.1 | hypothetical protein | - |
| PWP91_RS12660 (PWP91_12660) | - | 2507903..2508040 (-) | 138 | WP_011676905.1 | hypothetical protein | - |
| PWP91_RS12665 (PWP91_12665) | - | 2508037..2510574 (-) | 2538 | WP_274998619.1 | hypothetical protein | - |
| PWP91_RS12670 (PWP91_12670) | - | 2510586..2510951 (-) | 366 | WP_274998620.1 | DUF6711 family protein | - |
| PWP91_RS12675 (PWP91_12675) | - | 2510963..2515963 (-) | 5001 | WP_274998621.1 | phage tail protein | - |
| PWP91_RS12680 (PWP91_12680) | - | 2515996..2516367 (-) | 372 | WP_274998622.1 | hypothetical protein | - |
| PWP91_RS12685 (PWP91_12685) | - | 2516391..2516801 (-) | 411 | WP_011676909.1 | DUF6096 family protein | - |
| PWP91_RS12690 (PWP91_12690) | - | 2516877..2517116 (-) | 240 | WP_058219331.1 | Ig-like domain-containing protein | - |
| PWP91_RS12695 (PWP91_12695) | - | 2517142..2517555 (-) | 414 | WP_058203522.1 | hypothetical protein | - |
| PWP91_RS12700 (PWP91_12700) | - | 2517568..2517930 (-) | 363 | WP_274998623.1 | hypothetical protein | - |
| PWP91_RS12705 (PWP91_12705) | - | 2517930..2518478 (-) | 549 | WP_032946647.1 | hypothetical protein | - |
| PWP91_RS12710 (PWP91_12710) | - | 2518462..2518815 (-) | 354 | WP_081213603.1 | hypothetical protein | - |
| PWP91_RS12715 (PWP91_12715) | - | 2518796..2519128 (-) | 333 | WP_274998624.1 | phage head-tail connector protein | - |
| PWP91_RS12720 (PWP91_12720) | - | 2519149..2520267 (-) | 1119 | WP_274998625.1 | Ig-like domain-containing protein | - |
| PWP91_RS12725 (PWP91_12725) | - | 2520279..2520905 (-) | 627 | WP_274998626.1 | DUF4355 domain-containing protein | - |
| PWP91_RS12730 (PWP91_12730) | - | 2521070..2522176 (-) | 1107 | WP_274998627.1 | minor capsid protein | - |
| PWP91_RS12735 (PWP91_12735) | - | 2522186..2522563 (-) | 378 | WP_274998628.1 | hypothetical protein | - |
| PWP91_RS12740 (PWP91_12740) | - | 2522565..2522852 (-) | 288 | WP_274998629.1 | ribosomal-processing cysteine protease Prp | - |
| PWP91_RS12745 (PWP91_12745) | - | 2522849..2523004 (-) | 156 | WP_274998630.1 | hypothetical protein | - |
| PWP91_RS12750 (PWP91_12750) | - | 2522970..2524466 (-) | 1497 | WP_274998631.1 | phage portal protein | - |
| PWP91_RS12755 (PWP91_12755) | - | 2524476..2525765 (-) | 1290 | WP_420889566.1 | PBSX family phage terminase large subunit | - |
| PWP91_RS12760 (PWP91_12760) | - | 2525752..2526204 (-) | 453 | WP_139917177.1 | terminase small subunit | - |
| PWP91_RS12765 (PWP91_12765) | - | 2526438..2526860 (-) | 423 | WP_014024904.1 | RinA family protein | - |
| PWP91_RS12770 (PWP91_12770) | - | 2527136..2527480 (-) | 345 | WP_274998632.1 | hypothetical protein | - |
| PWP91_RS12775 (PWP91_12775) | - | 2527482..2527775 (-) | 294 | WP_274998633.1 | DUF1359 domain-containing protein | - |
| PWP91_RS12780 (PWP91_12780) | - | 2528187..2528627 (+) | 441 | WP_274998634.1 | DUF2798 domain-containing protein | - |
| PWP91_RS12785 (PWP91_12785) | - | 2528727..2529140 (-) | 414 | WP_274998635.1 | hypothetical protein | - |
| PWP91_RS12790 (PWP91_12790) | - | 2529137..2529502 (-) | 366 | WP_274998636.1 | hypothetical protein | - |
| PWP91_RS12795 (PWP91_12795) | - | 2529599..2529802 (-) | 204 | WP_274998637.1 | hypothetical protein | - |
| PWP91_RS12800 (PWP91_12800) | - | 2529799..2529996 (-) | 198 | WP_274998638.1 | hypothetical protein | - |
| PWP91_RS12805 (PWP91_12805) | - | 2529993..2530637 (-) | 645 | WP_274998639.1 | DUF1642 domain-containing protein | - |
| PWP91_RS12810 (PWP91_12810) | - | 2530630..2530872 (-) | 243 | WP_274998640.1 | hypothetical protein | - |
| PWP91_RS12815 (PWP91_12815) | - | 2531199..2531609 (-) | 411 | WP_274998641.1 | hypothetical protein | - |
| PWP91_RS12820 (PWP91_12820) | - | 2531622..2531864 (-) | 243 | WP_274998642.1 | hypothetical protein | - |
| PWP91_RS12825 (PWP91_12825) | - | 2531857..2532771 (-) | 915 | WP_274998643.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PWP91_RS12830 (PWP91_12830) | - | 2533039..2533839 (-) | 801 | WP_274998644.1 | recombinase RecT | - |
| PWP91_RS12835 (PWP91_12835) | - | 2533832..2534668 (-) | 837 | WP_274998645.1 | hypothetical protein | - |
| PWP91_RS12840 (PWP91_12840) | - | 2534771..2535019 (-) | 249 | WP_274998646.1 | hypothetical protein | - |
| PWP91_RS12845 (PWP91_12845) | - | 2535159..2535353 (-) | 195 | WP_274998647.1 | hypothetical protein | - |
| PWP91_RS12850 (PWP91_12850) | - | 2535366..2536160 (-) | 795 | WP_274998648.1 | phage antirepressor KilAC domain-containing protein | - |
| PWP91_RS12855 (PWP91_12855) | - | 2536172..2536411 (-) | 240 | WP_274998649.1 | helix-turn-helix domain-containing protein | - |
| PWP91_RS12860 (PWP91_12860) | - | 2536567..2537238 (+) | 672 | WP_274998650.1 | DUF4145 domain-containing protein | - |
| PWP91_RS12865 (PWP91_12865) | - | 2537210..2537416 (-) | 207 | WP_046782288.1 | hypothetical protein | - |
| PWP91_RS12870 (PWP91_12870) | - | 2537666..2538517 (+) | 852 | WP_274998651.1 | helix-turn-helix domain-containing protein | - |
| PWP91_RS12875 (PWP91_12875) | - | 2538543..2538740 (+) | 198 | WP_046124795.1 | hypothetical protein | - |
| PWP91_RS12880 (PWP91_12880) | - | 2538800..2539351 (+) | 552 | WP_274998652.1 | hypothetical protein | - |
| PWP91_RS12885 (PWP91_12885) | - | 2539472..2540929 (+) | 1458 | WP_274998653.1 | recombinase family protein | - |
| PWP91_RS12890 (PWP91_12890) | - | 2540926..2541066 (-) | 141 | WP_247649129.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10113.52 Da Isoelectric Point: 4.2950
>NTDB_id=794830 PWP91_RS12610 WP_023349160.1 2500696..2500965(-) (comGC) [Lactococcus lactis strain P-1]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=794830 PWP91_RS12610 WP_023349160.1 2500696..2500965(-) (comGC) [Lactococcus lactis strain P-1]
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
88 |
84.27 |
0.742 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
57.647 |
95.506 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
55.263 |
85.393 |
0.472 |
| comYC | Streptococcus mutans UA140 |
52.055 |
82.022 |
0.427 |
| comYC | Streptococcus mutans UA159 |
52.055 |
82.022 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
57.812 |
71.91 |
0.416 |