Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   PWP91_RS12605 Genome accession   NZ_CP118738
Coordinates   2500305..2500736 (-) Length   143 a.a.
NCBI ID   WP_012898621.1    Uniprot ID   -
Organism   Lactococcus lactis strain P-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2497034..2542099 2500305..2500736 within 0


Gene organization within MGE regions


Location: 2497034..2542099
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWP91_RS12575 (PWP91_12575) - 2497034..2497771 (-) 738 WP_058211243.1 metal ABC transporter ATP-binding protein -
  PWP91_RS12580 (PWP91_12580) - 2497948..2498790 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  PWP91_RS12585 (PWP91_12585) - 2498787..2499224 (-) 438 WP_274998612.1 zinc-dependent MarR family transcriptional regulator -
  PWP91_RS12590 (PWP91_12590) comGG 2499305..2499589 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  PWP91_RS12595 (PWP91_12595) comGF 2499628..2500074 (-) 447 WP_032948129.1 competence type IV pilus minor pilin ComGF Machinery gene
  PWP91_RS12600 (PWP91_12600) comGE 2500037..2500333 (-) 297 WP_250354455.1 competence type IV pilus minor pilin ComGE Machinery gene
  PWP91_RS12605 (PWP91_12605) comGD 2500305..2500736 (-) 432 WP_012898621.1 competence type IV pilus minor pilin ComGD Machinery gene
  PWP91_RS12610 (PWP91_12610) comGC 2500696..2500965 (-) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  PWP91_RS12620 (PWP91_12620) - 2501462..2501662 (-) 201 WP_058203534.1 cold-shock protein -
  PWP91_RS12625 (PWP91_12625) - 2502719..2502862 (-) 144 WP_014573124.1 hypothetical protein -
  PWP91_RS12630 (PWP91_12630) - 2502938..2504410 (-) 1473 WP_274998613.1 ATP-binding protein -
  PWP91_RS12635 (PWP91_12635) - 2504550..2504828 (-) 279 WP_274998614.1 hypothetical protein -
  PWP91_RS12640 (PWP91_12640) - 2504909..2506192 (-) 1284 WP_274998615.1 LysM peptidoglycan-binding domain-containing protein -
  PWP91_RS12645 (PWP91_12645) - 2506189..2506413 (-) 225 WP_274998616.1 phage holin -
  PWP91_RS12650 (PWP91_12650) - 2506426..2506785 (-) 360 WP_274998617.1 hypothetical protein -
  PWP91_RS12655 (PWP91_12655) - 2506803..2507903 (-) 1101 WP_274998618.1 hypothetical protein -
  PWP91_RS12660 (PWP91_12660) - 2507903..2508040 (-) 138 WP_011676905.1 hypothetical protein -
  PWP91_RS12665 (PWP91_12665) - 2508037..2510574 (-) 2538 WP_274998619.1 hypothetical protein -
  PWP91_RS12670 (PWP91_12670) - 2510586..2510951 (-) 366 WP_274998620.1 DUF6711 family protein -
  PWP91_RS12675 (PWP91_12675) - 2510963..2515963 (-) 5001 WP_274998621.1 phage tail protein -
  PWP91_RS12680 (PWP91_12680) - 2515996..2516367 (-) 372 WP_274998622.1 hypothetical protein -
  PWP91_RS12685 (PWP91_12685) - 2516391..2516801 (-) 411 WP_011676909.1 DUF6096 family protein -
  PWP91_RS12690 (PWP91_12690) - 2516877..2517116 (-) 240 WP_058219331.1 Ig-like domain-containing protein -
  PWP91_RS12695 (PWP91_12695) - 2517142..2517555 (-) 414 WP_058203522.1 hypothetical protein -
  PWP91_RS12700 (PWP91_12700) - 2517568..2517930 (-) 363 WP_274998623.1 hypothetical protein -
  PWP91_RS12705 (PWP91_12705) - 2517930..2518478 (-) 549 WP_032946647.1 hypothetical protein -
  PWP91_RS12710 (PWP91_12710) - 2518462..2518815 (-) 354 WP_081213603.1 hypothetical protein -
  PWP91_RS12715 (PWP91_12715) - 2518796..2519128 (-) 333 WP_274998624.1 phage head-tail connector protein -
  PWP91_RS12720 (PWP91_12720) - 2519149..2520267 (-) 1119 WP_274998625.1 Ig-like domain-containing protein -
  PWP91_RS12725 (PWP91_12725) - 2520279..2520905 (-) 627 WP_274998626.1 DUF4355 domain-containing protein -
  PWP91_RS12730 (PWP91_12730) - 2521070..2522176 (-) 1107 WP_274998627.1 minor capsid protein -
  PWP91_RS12735 (PWP91_12735) - 2522186..2522563 (-) 378 WP_274998628.1 hypothetical protein -
  PWP91_RS12740 (PWP91_12740) - 2522565..2522852 (-) 288 WP_274998629.1 ribosomal-processing cysteine protease Prp -
  PWP91_RS12745 (PWP91_12745) - 2522849..2523004 (-) 156 WP_274998630.1 hypothetical protein -
  PWP91_RS12750 (PWP91_12750) - 2522970..2524466 (-) 1497 WP_274998631.1 phage portal protein -
  PWP91_RS12755 (PWP91_12755) - 2524476..2525765 (-) 1290 WP_420889566.1 PBSX family phage terminase large subunit -
  PWP91_RS12760 (PWP91_12760) - 2525752..2526204 (-) 453 WP_139917177.1 terminase small subunit -
  PWP91_RS12765 (PWP91_12765) - 2526438..2526860 (-) 423 WP_014024904.1 RinA family protein -
  PWP91_RS12770 (PWP91_12770) - 2527136..2527480 (-) 345 WP_274998632.1 hypothetical protein -
  PWP91_RS12775 (PWP91_12775) - 2527482..2527775 (-) 294 WP_274998633.1 DUF1359 domain-containing protein -
  PWP91_RS12780 (PWP91_12780) - 2528187..2528627 (+) 441 WP_274998634.1 DUF2798 domain-containing protein -
  PWP91_RS12785 (PWP91_12785) - 2528727..2529140 (-) 414 WP_274998635.1 hypothetical protein -
  PWP91_RS12790 (PWP91_12790) - 2529137..2529502 (-) 366 WP_274998636.1 hypothetical protein -
  PWP91_RS12795 (PWP91_12795) - 2529599..2529802 (-) 204 WP_274998637.1 hypothetical protein -
  PWP91_RS12800 (PWP91_12800) - 2529799..2529996 (-) 198 WP_274998638.1 hypothetical protein -
  PWP91_RS12805 (PWP91_12805) - 2529993..2530637 (-) 645 WP_274998639.1 DUF1642 domain-containing protein -
  PWP91_RS12810 (PWP91_12810) - 2530630..2530872 (-) 243 WP_274998640.1 hypothetical protein -
  PWP91_RS12815 (PWP91_12815) - 2531199..2531609 (-) 411 WP_274998641.1 hypothetical protein -
  PWP91_RS12820 (PWP91_12820) - 2531622..2531864 (-) 243 WP_274998642.1 hypothetical protein -
  PWP91_RS12825 (PWP91_12825) - 2531857..2532771 (-) 915 WP_274998643.1 phage replisome organizer N-terminal domain-containing protein -
  PWP91_RS12830 (PWP91_12830) - 2533039..2533839 (-) 801 WP_274998644.1 recombinase RecT -
  PWP91_RS12835 (PWP91_12835) - 2533832..2534668 (-) 837 WP_274998645.1 hypothetical protein -
  PWP91_RS12840 (PWP91_12840) - 2534771..2535019 (-) 249 WP_274998646.1 hypothetical protein -
  PWP91_RS12845 (PWP91_12845) - 2535159..2535353 (-) 195 WP_274998647.1 hypothetical protein -
  PWP91_RS12850 (PWP91_12850) - 2535366..2536160 (-) 795 WP_274998648.1 phage antirepressor KilAC domain-containing protein -
  PWP91_RS12855 (PWP91_12855) - 2536172..2536411 (-) 240 WP_274998649.1 helix-turn-helix domain-containing protein -
  PWP91_RS12860 (PWP91_12860) - 2536567..2537238 (+) 672 WP_274998650.1 DUF4145 domain-containing protein -
  PWP91_RS12865 (PWP91_12865) - 2537210..2537416 (-) 207 WP_046782288.1 hypothetical protein -
  PWP91_RS12870 (PWP91_12870) - 2537666..2538517 (+) 852 WP_274998651.1 helix-turn-helix domain-containing protein -
  PWP91_RS12875 (PWP91_12875) - 2538543..2538740 (+) 198 WP_046124795.1 hypothetical protein -
  PWP91_RS12880 (PWP91_12880) - 2538800..2539351 (+) 552 WP_274998652.1 hypothetical protein -
  PWP91_RS12885 (PWP91_12885) - 2539472..2540929 (+) 1458 WP_274998653.1 recombinase family protein -
  PWP91_RS12890 (PWP91_12890) - 2540926..2541066 (-) 141 WP_247649129.1 hypothetical protein -

Sequence

Protein


Download         Length: 143 a.a.        Molecular weight: 16546.59 Da        Isoelectric Point: 9.6891

>NTDB_id=794829 PWP91_RS12605 WP_012898621.1 2500305..2500736(-) (comGD) [Lactococcus lactis strain P-1]
MIRIKMKNEILMTRAFTLLESLLVLLIISFITTLFSLEIIQTVHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQ
ELICEDRSITIPKEVAVKDFTVKFDDKGGNSSLQKLTIFLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide


Download         Length: 432 bp        

>NTDB_id=794829 PWP91_RS12605 WP_012898621.1 2500305..2500736(-) (comGD) [Lactococcus lactis strain P-1]
ATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGAT
TATTTCTTTTATCACTACTCTTTTTTCTTTAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAACTGTTTGTTCTCC
AGTTTGAAAATTTCTATAAAAGGAGTCAAGAAGATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAA
GAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAA
GGGAGGGAATTCTAGCTTACAAAAACTCACAATTTTTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAG
GCAGTGGAAAATTTAAAAAGAAAATCAGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

67.133

100

0.671
  comYD Streptococcus gordonii str. Challis substr. CH1

39.007

98.601

0.385
  comYD Streptococcus mutans UA140

40.625

89.51

0.364
  comYD Streptococcus mutans UA159

40.625

89.51

0.364