Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PUW74_RS09760 | Genome accession | NZ_CP118080 |
| Coordinates | 1917343..1917759 (-) | Length | 138 a.a. |
| NCBI ID | WP_000609565.1 | Uniprot ID | Q8DXI7 |
| Organism | Streptococcus agalactiae strain VSI14 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1893906..1932515 | 1917343..1917759 | within | 0 |
Gene organization within MGE regions
Location: 1893906..1932515
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW74_RS09615 (PUW74_09615) | - | 1893906..1894310 (-) | 405 | WP_000878126.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PUW74_RS09620 (PUW74_09620) | - | 1894371..1894556 (-) | 186 | WP_000139836.1 | type II toxin-antitoxin system HicA family toxin | - |
| PUW74_RS09625 (PUW74_09625) | - | 1894763..1896169 (-) | 1407 | WP_000405192.1 | peptidoglycan amidohydrolase family protein | - |
| PUW74_RS09630 (PUW74_09630) | - | 1896173..1896502 (-) | 330 | WP_000192161.1 | phage holin | - |
| PUW74_RS09635 (PUW74_09635) | - | 1896505..1896915 (-) | 411 | WP_001135353.1 | hypothetical protein | - |
| PUW74_RS09640 (PUW74_09640) | - | 1896950..1897288 (-) | 339 | WP_000213866.1 | hypothetical protein | - |
| PUW74_RS09645 (PUW74_09645) | - | 1897291..1897521 (-) | 231 | WP_001071121.1 | hypothetical protein | - |
| PUW74_RS09650 (PUW74_09650) | - | 1897538..1901212 (-) | 3675 | WP_071661712.1 | phage tail spike protein | - |
| PUW74_RS09655 (PUW74_09655) | - | 1901213..1901935 (-) | 723 | WP_000161557.1 | hypothetical protein | - |
| PUW74_RS09660 (PUW74_09660) | - | 1901932..1904667 (-) | 2736 | WP_071661713.1 | phage tail tape measure protein | - |
| PUW74_RS09665 (PUW74_09665) | - | 1904686..1904814 (-) | 129 | WP_011058372.1 | hypothetical protein | - |
| PUW74_RS09670 (PUW74_09670) | - | 1904853..1905329 (-) | 477 | WP_000591558.1 | hypothetical protein | - |
| PUW74_RS09675 (PUW74_09675) | - | 1905329..1906012 (-) | 684 | WP_071661714.1 | phage tail protein | - |
| PUW74_RS09680 (PUW74_09680) | - | 1906027..1906371 (-) | 345 | WP_000508738.1 | hypothetical protein | - |
| PUW74_RS09685 (PUW74_09685) | - | 1906358..1906705 (-) | 348 | WP_001074486.1 | hypothetical protein | - |
| PUW74_RS09690 (PUW74_09690) | - | 1906705..1907010 (-) | 306 | WP_000842789.1 | head-tail adaptor protein | - |
| PUW74_RS09695 (PUW74_09695) | - | 1907007..1907342 (-) | 336 | WP_000153862.1 | hypothetical protein | - |
| PUW74_RS09700 (PUW74_09700) | - | 1907363..1908625 (-) | 1263 | WP_000749070.1 | phage major capsid protein | - |
| PUW74_RS09705 (PUW74_09705) | - | 1908636..1909178 (-) | 543 | WP_000413200.1 | HK97 family phage prohead protease | - |
| PUW74_RS09710 (PUW74_09710) | - | 1909228..1910370 (-) | 1143 | WP_001067328.1 | phage portal protein | - |
| PUW74_RS09715 (PUW74_09715) | - | 1910379..1912091 (-) | 1713 | WP_000230004.1 | terminase TerL endonuclease subunit | - |
| PUW74_RS09720 (PUW74_09720) | - | 1912084..1912569 (-) | 486 | WP_000601035.1 | hypothetical protein | - |
| PUW74_RS09725 (PUW74_09725) | - | 1912657..1912905 (-) | 249 | WP_153204907.1 | HNH endonuclease | - |
| PUW74_RS09730 (PUW74_09730) | - | 1913016..1913303 (-) | 288 | WP_000651009.1 | hypothetical protein | - |
| PUW74_RS09735 (PUW74_09735) | - | 1913593..1914135 (-) | 543 | WP_001028147.1 | site-specific integrase | - |
| PUW74_RS09740 (PUW74_09740) | - | 1914245..1914709 (-) | 465 | WP_000163169.1 | hypothetical protein | - |
| PUW74_RS09745 (PUW74_09745) | - | 1914706..1915065 (-) | 360 | WP_011058373.1 | helix-turn-helix transcriptional regulator | - |
| PUW74_RS09750 (PUW74_09750) | - | 1915050..1915310 (-) | 261 | WP_001008140.1 | hypothetical protein | - |
| PUW74_RS09755 (PUW74_09755) | ltrA | 1915443..1916762 (-) | 1320 | WP_000561483.1 | group II intron reverse transcriptase/maturase | - |
| PUW74_RS09760 (PUW74_09760) | ssb | 1917343..1917759 (-) | 417 | WP_000609565.1 | single-stranded DNA-binding protein | Machinery gene |
| PUW74_RS09765 (PUW74_09765) | - | 1917749..1917955 (-) | 207 | WP_000748199.1 | hypothetical protein | - |
| PUW74_RS09770 (PUW74_09770) | - | 1917952..1918179 (-) | 228 | WP_070467532.1 | DUF3310 domain-containing protein | - |
| PUW74_RS09775 (PUW74_09775) | - | 1918308..1918637 (-) | 330 | WP_000793494.1 | DUF1372 family protein | - |
| PUW74_RS09780 (PUW74_09780) | - | 1918637..1919128 (-) | 492 | WP_000169322.1 | MazG-like family protein | - |
| PUW74_RS09785 (PUW74_09785) | - | 1919257..1919319 (-) | 63 | Protein_1855 | DNA cytosine methyltransferase | - |
| PUW74_RS09790 (PUW74_09790) | - | 1919319..1920140 (-) | 822 | WP_001067867.1 | ATP-binding protein | - |
| PUW74_RS09795 (PUW74_09795) | - | 1920141..1920302 (-) | 162 | Protein_1857 | conserved phage C-terminal domain-containing protein | - |
| PUW74_RS09800 (PUW74_09800) | - | 1920812..1922590 (+) | 1779 | WP_001258309.1 | reverse transcriptase/maturase family protein | - |
| PUW74_RS09805 (PUW74_09805) | - | 1922689..1923282 (-) | 594 | WP_274982454.1 | conserved phage C-terminal domain-containing protein | - |
| PUW74_RS09810 (PUW74_09810) | - | 1923260..1923865 (-) | 606 | WP_079219474.1 | hypothetical protein | - |
| PUW74_RS09815 (PUW74_09815) | dnaB | 1923865..1925196 (-) | 1332 | WP_000343908.1 | replicative DNA helicase | - |
| PUW74_RS09820 (PUW74_09820) | - | 1925205..1925420 (-) | 216 | WP_001061697.1 | hypothetical protein | - |
| PUW74_RS09825 (PUW74_09825) | - | 1925437..1925721 (-) | 285 | WP_000998973.1 | hypothetical protein | - |
| PUW74_RS09830 (PUW74_09830) | - | 1925781..1926491 (-) | 711 | WP_001002368.1 | ORF6C domain-containing protein | - |
| PUW74_RS09835 (PUW74_09835) | - | 1926494..1926703 (-) | 210 | WP_000082755.1 | helix-turn-helix transcriptional regulator | - |
| PUW74_RS09840 (PUW74_09840) | - | 1926764..1927234 (+) | 471 | WP_001052630.1 | hypothetical protein | - |
| PUW74_RS09845 (PUW74_09845) | - | 1927217..1927381 (-) | 165 | WP_000511144.1 | hypothetical protein | - |
| PUW74_RS09850 (PUW74_09850) | - | 1927667..1928029 (+) | 363 | WP_000114553.1 | helix-turn-helix transcriptional regulator | - |
| PUW74_RS09855 (PUW74_09855) | - | 1928036..1928416 (+) | 381 | WP_000762727.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PUW74_RS09860 (PUW74_09860) | - | 1928469..1928873 (+) | 405 | WP_001173134.1 | DUF4429 domain-containing protein | - |
| PUW74_RS09865 (PUW74_09865) | - | 1928995..1930065 (+) | 1071 | WP_000179397.1 | site-specific integrase | - |
| PUW74_RS09870 (PUW74_09870) | - | 1930208..1932277 (-) | 2070 | WP_000393089.1 | sodium:proton antiporter | - |
| PUW74_RS09875 (PUW74_09875) | - | 1932279..1932515 (-) | 237 | WP_000080857.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15674.52 Da Isoelectric Point: 4.6604
>NTDB_id=789971 PUW74_RS09760 WP_000609565.1 1917343..1917759(-) (ssb) [Streptococcus agalactiae strain VSI14]
MINNVVLIGRLTRDVELRYTPSNIANATFNLAVNRNFKNAAGDREADFINCVMWRQQAENLANWTKKGMLIGITGRIQTR
SYENQQGQRIYVTEVVADSFQILEKRDNSTNQASMDDQLPPSFGNSQPMDISDDDLPF
MINNVVLIGRLTRDVELRYTPSNIANATFNLAVNRNFKNAAGDREADFINCVMWRQQAENLANWTKKGMLIGITGRIQTR
SYENQQGQRIYVTEVVADSFQILEKRDNSTNQASMDDQLPPSFGNSQPMDISDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=789971 PUW74_RS09760 WP_000609565.1 1917343..1917759(-) (ssb) [Streptococcus agalactiae strain VSI14]
ATGATCAATAATGTTGTACTTATTGGCCGCTTGACAAGAGATGTTGAGCTACGTTACACGCCGTCAAACATCGCAAACGC
TACTTTTAACCTAGCAGTCAATCGAAATTTCAAGAATGCTGCTGGTGATCGTGAAGCTGATTTCATCAACTGTGTGATGT
GGCGACAACAAGCTGAAAACTTGGCCAATTGGACGAAAAAAGGAATGCTGATTGGTATTACTGGACGAATCCAGACAAGA
AGCTACGAAAATCAGCAAGGTCAGCGTATCTATGTGACTGAGGTTGTTGCTGACAGCTTCCAGATTCTTGAAAAGCGTGA
TAATTCAACGAACCAGGCAAGCATGGATGACCAATTGCCACCATCATTTGGAAATAGTCAGCCTATGGATATTTCAGATG
ATGATCTACCGTTTTGA
ATGATCAATAATGTTGTACTTATTGGCCGCTTGACAAGAGATGTTGAGCTACGTTACACGCCGTCAAACATCGCAAACGC
TACTTTTAACCTAGCAGTCAATCGAAATTTCAAGAATGCTGCTGGTGATCGTGAAGCTGATTTCATCAACTGTGTGATGT
GGCGACAACAAGCTGAAAACTTGGCCAATTGGACGAAAAAAGGAATGCTGATTGGTATTACTGGACGAATCCAGACAAGA
AGCTACGAAAATCAGCAAGGTCAGCGTATCTATGTGACTGAGGTTGTTGCTGACAGCTTCCAGATTCTTGAAAAGCGTGA
TAATTCAACGAACCAGGCAAGCATGGATGACCAATTGCCACCATCATTTGGAAATAGTCAGCCTATGGATATTTCAGATG
ATGATCTACCGTTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.575 |
100 |
0.638 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.259 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
76.812 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.559 |
100 |
0.42 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.943 |
76.812 |
0.391 |