NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	Q3V56_RS07655	Genome accession	NZ_CP130518
Coordinates	1598278..1598589 (-)	Length	103 a.a.
NCBI ID	WP_000472256.1	Uniprot ID	A0A0H2XGS7
Organism	Staphylococcus aureus strain SA25-SX
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1593278..1603589

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Q3V56_RS07620	gcvPA	1593780..1595126 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
Q3V56_RS07625	gcvT	1595146..1596237 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
Q3V56_RS07630	-	1596396..1596920 (-)	525	WP_001015116.1	shikimate kinase	-
Q3V56_RS07635	-	1596910..1597056 (-)	147	WP_001789879.1	hypothetical protein	-
Q3V56_RS07640	comGF	1597153..1597650 (-)	498	WP_001838632.1	competence type IV pilus minor pilin ComGF	Machinery gene
Q3V56_RS07645	comGE	1597568..1597867 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
Q3V56_RS07650	comGD	1597854..1598300 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
Q3V56_RS07655	comGC	1598278..1598589 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
Q3V56_RS07660	comGB	1598603..1599673 (-)	1071	WP_000776407.1	competence type IV pilus assembly protein ComGB	Machinery gene
Q3V56_RS07665	comGA	1599645..1600619 (-)	975	WP_000697218.1	competence type IV pilus ATPase ComGA	Machinery gene
Q3V56_RS07670	-	1600671..1601294 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
Q3V56_RS07675	-	1601291..1601620 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
Q3V56_RS07680	-	1601620..1602606 (-)	987	WP_000161315.1	ROK family glucokinase	-
Q3V56_RS07685	-	1602603..1602806 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268

                                >NTDB_id=783592 Q3V56_RS07655 WP_000472256.1 1598278..1598589(-) (comGC) [Staphylococcus aureus strain SA25-SX]

MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI

KEAQKTCKSGETITISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=783592 Q3V56_RS07655 WP_000472256.1 1598278..1598589(-) (comGC) [Staphylococcus aureus strain SA25-SX]

ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT

AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA

ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA

AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0H2XGS7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comGC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369

Detailed information NTG0783592