Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | PQQ74_RS07465 | Genome accession | NZ_CP117203 |
| Coordinates | 1560622..1560933 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 2022QW-00133 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1555622..1565933
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ74_RS07430 (PQQ74_07430) | gcvPA | 1556124..1557470 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| PQQ74_RS07435 (PQQ74_07435) | gcvT | 1557490..1558581 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PQQ74_RS07440 (PQQ74_07440) | - | 1558740..1559264 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| PQQ74_RS07445 (PQQ74_07445) | - | 1559254..1559400 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| PQQ74_RS07450 (PQQ74_07450) | comGF | 1559497..1559994 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| PQQ74_RS07455 (PQQ74_07455) | comGE | 1559912..1560211 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| PQQ74_RS07460 (PQQ74_07460) | comGD | 1560198..1560644 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| PQQ74_RS07465 (PQQ74_07465) | comGC | 1560622..1560933 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PQQ74_RS07470 (PQQ74_07470) | comGB | 1560947..1562017 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| PQQ74_RS07475 (PQQ74_07475) | comGA | 1561989..1562963 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| PQQ74_RS07480 (PQQ74_07480) | - | 1563015..1563638 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| PQQ74_RS07485 (PQQ74_07485) | - | 1563635..1563964 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| PQQ74_RS07490 (PQQ74_07490) | - | 1563964..1564950 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| PQQ74_RS07495 (PQQ74_07495) | - | 1564947..1565150 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=782849 PQQ74_RS07465 WP_000472256.1 1560622..1560933(-) (comGC) [Staphylococcus aureus strain 2022QW-00133]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=782849 PQQ74_RS07465 WP_000472256.1 1560622..1560933(-) (comGC) [Staphylococcus aureus strain 2022QW-00133]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |