Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PO880_RS13160 | Genome accession | NZ_CP116962 |
| Coordinates | 2736210..2736668 (-) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain DM86 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2680143..2743598 | 2736210..2736668 | within | 0 |
Gene organization within MGE regions
Location: 2680143..2743598
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO880_RS12880 (PO880_12880) | - | 2680846..2681979 (-) | 1134 | WP_002377959.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| PO880_RS12885 (PO880_12885) | - | 2682081..2683151 (-) | 1071 | WP_010710139.1 | ammonium transporter | - |
| PO880_RS12890 (PO880_12890) | - | 2683345..2683748 (-) | 404 | Protein_2534 | NusG domain II-containing protein | - |
| PO880_RS12895 (PO880_12895) | - | 2683800..2684177 (-) | 378 | WP_002382844.1 | hypothetical protein | - |
| PO880_RS12900 (PO880_12900) | rpmF | 2684199..2684372 (-) | 174 | WP_002358539.1 | 50S ribosomal protein L32 | - |
| PO880_RS12905 (PO880_12905) | - | 2684665..2685720 (+) | 1056 | WP_002401430.1 | YibE/F family protein | - |
| PO880_RS12910 (PO880_12910) | - | 2685717..2686481 (+) | 765 | WP_002358536.1 | YibE/F family protein | - |
| PO880_RS12915 (PO880_12915) | - | 2687114..2687596 (-) | 483 | WP_002358535.1 | PTS sugar transporter subunit IIA | - |
| PO880_RS12920 (PO880_12920) | - | 2687607..2689109 (-) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| PO880_RS12925 (PO880_12925) | - | 2689102..2689809 (-) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| PO880_RS12930 (PO880_12930) | - | 2689965..2690783 (+) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| PO880_RS12935 (PO880_12935) | - | 2691239..2691421 (-) | 183 | WP_002358529.1 | hypothetical protein | - |
| PO880_RS12940 (PO880_12940) | - | 2691530..2692149 (-) | 620 | Protein_2544 | recombinase family protein | - |
| PO880_RS12945 (PO880_12945) | - | 2692333..2692953 (+) | 621 | WP_033591050.1 | recombinase family protein | - |
| PO880_RS12950 (PO880_12950) | - | 2692999..2693736 (-) | 738 | WP_002401428.1 | hypothetical protein | - |
| PO880_RS12955 (PO880_12955) | - | 2693724..2693825 (+) | 102 | Protein_2547 | IS30 family transposase | - |
| PO880_RS12960 (PO880_12960) | - | 2693961..2694377 (-) | 417 | WP_002358522.1 | hypothetical protein | - |
| PO880_RS12965 (PO880_12965) | - | 2694507..2695715 (-) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| PO880_RS12970 (PO880_12970) | - | 2695915..2701536 (-) | 5622 | WP_202289641.1 | Rib/alpha-like domain-containing protein | - |
| PO880_RS12975 (PO880_12975) | - | 2701811..2702347 (-) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| PO880_RS12980 (PO880_12980) | - | 2702376..2702567 (-) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| PO880_RS12985 (PO880_12985) | amaP | 2702584..2703150 (-) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| PO880_RS12990 (PO880_12990) | - | 2703420..2703707 (-) | 288 | WP_306418522.1 | S41 family peptidase | - |
| PO880_RS12995 (PO880_12995) | - | 2703721..2704302 (-) | 582 | WP_002401490.1 | hypothetical protein | - |
| PO880_RS13000 (PO880_13000) | - | 2704380..2704847 (-) | 468 | WP_002370921.1 | hypothetical protein | - |
| PO880_RS13005 (PO880_13005) | - | 2705284..2705847 (-) | 564 | WP_002370925.1 | hypothetical protein | - |
| PO880_RS13010 (PO880_13010) | - | 2706200..2707183 (-) | 984 | WP_002368282.1 | site-2 protease family protein | - |
| PO880_RS13015 (PO880_13015) | - | 2707184..2708422 (-) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| PO880_RS13020 (PO880_13020) | - | 2708419..2710563 (-) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| PO880_RS13025 (PO880_13025) | - | 2710575..2713556 (-) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| PO880_RS13030 (PO880_13030) | cylL-S | 2713617..2713808 (-) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| PO880_RS13035 (PO880_13035) | cylL-L | 2713842..2714048 (-) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| PO880_RS13040 (PO880_13040) | cylR2 | 2714452..2714652 (+) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| PO880_RS13045 (PO880_13045) | - | 2714990..2715304 (-) | 315 | WP_002403043.1 | hypothetical protein | - |
| PO880_RS13050 (PO880_13050) | - | 2715477..2716121 (-) | 645 | WP_272731503.1 | IS6 family transposase | - |
| PO880_RS13055 (PO880_13055) | - | 2716254..2717136 (+) | 883 | Protein_2567 | IS256 family transposase | - |
| PO880_RS13060 (PO880_13060) | - | 2717441..2718478 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| PO880_RS13065 (PO880_13065) | - | 2718504..2719442 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| PO880_RS13070 (PO880_13070) | - | 2719570..2719839 (-) | 270 | Protein_2570 | LPXTG cell wall anchor domain-containing protein | - |
| PO880_RS13075 (PO880_13075) | - | 2719929..2720114 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| PO880_RS13080 (PO880_13080) | - | 2720146..2720754 (+) | 609 | Protein_2572 | IS6 family transposase | - |
| PO880_RS13085 (PO880_13085) | bsh | 2721423..2722397 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| PO880_RS13090 (PO880_13090) | - | 2722621..2723265 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| PO880_RS13095 (PO880_13095) | - | 2723456..2723731 (-) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| PO880_RS13100 (PO880_13100) | - | 2723724..2723990 (-) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| PO880_RS13105 (PO880_13105) | - | 2724101..2724685 (-) | 585 | WP_272731505.1 | thermonuclease family protein | - |
| PO880_RS13110 (PO880_13110) | - | 2724709..2725125 (-) | 417 | WP_272731507.1 | single-stranded DNA-binding protein | - |
| PO880_RS13115 (PO880_13115) | - | 2725201..2725449 (-) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| PO880_RS13120 (PO880_13120) | - | 2725462..2725962 (-) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| PO880_RS13125 (PO880_13125) | - | 2725995..2726261 (-) | 267 | WP_002377947.1 | hypothetical protein | - |
| PO880_RS13130 (PO880_13130) | - | 2726853..2727341 (-) | 489 | WP_010710133.1 | hypothetical protein | - |
| PO880_RS13135 (PO880_13135) | - | 2727347..2728132 (-) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| PO880_RS13140 (PO880_13140) | - | 2728655..2730913 (-) | 2259 | WP_010710132.1 | type IV secretory system conjugative DNA transfer family protein | - |
| PO880_RS13145 (PO880_13145) | - | 2730900..2733245 (-) | 2346 | WP_002377940.1 | CD3337/EF1877 family mobilome membrane protein | - |
| PO880_RS13150 (PO880_13150) | - | 2733258..2733656 (-) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| PO880_RS13155 (PO880_13155) | - | 2733613..2736105 (-) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| PO880_RS13160 (PO880_13160) | ssb | 2736210..2736668 (-) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| PO880_RS13165 (PO880_13165) | - | 2736761..2737243 (-) | 483 | WP_002360790.1 | hypothetical protein | - |
| PO880_RS13170 (PO880_13170) | - | 2737275..2737664 (-) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| PO880_RS13175 (PO880_13175) | - | 2737664..2737924 (-) | 261 | WP_010706916.1 | hypothetical protein | - |
| PO880_RS13180 (PO880_13180) | - | 2737929..2738963 (-) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| PO880_RS13185 (PO880_13185) | - | 2738956..2739270 (-) | 315 | WP_002360796.1 | hypothetical protein | - |
| PO880_RS13190 (PO880_13190) | - | 2739270..2739686 (-) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| PO880_RS13195 (PO880_13195) | - | 2739670..2740287 (-) | 618 | WP_272731510.1 | hypothetical protein | - |
| PO880_RS13200 (PO880_13200) | - | 2740290..2741561 (-) | 1272 | WP_002415819.1 | CHAP domain-containing protein | - |
| PO880_RS13205 (PO880_13205) | - | 2741587..2742447 (-) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| PO880_RS13210 (PO880_13210) | - | 2742467..2743345 (-) | 879 | WP_002377931.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=781760 PO880_RS13160 WP_002365911.1 2736210..2736668(-) (ssb) [Enterococcus faecalis strain DM86]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=781760 PO880_RS13160 WP_002365911.1 2736210..2736668(-) (ssb) [Enterococcus faecalis strain DM86]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |