Detailed information NTG0772259

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PDI56_RS02420
• Genome accession: NZ_CP115473
• Coordinates: 449241..449552 (+)
• Length: 103 a.a.
• NCBI ID: WP_031786220.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain AF4004
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 444241..454552

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PDI56_RS02390 (PDI56_02385)	-	445024..445227 (+)	204	WP_000087561.1	YqgQ family protein	-
PDI56_RS02395 (PDI56_02390)	-	445224..446210 (+)	987	WP_000161311.1	ROK family glucokinase	-
PDI56_RS02400 (PDI56_02395)	-	446210..446539 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
PDI56_RS02405 (PDI56_02400)	-	446536..447159 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
PDI56_RS02410 (PDI56_02405)	comGA	447211..448185 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
PDI56_RS02415 (PDI56_02410)	comGB	448157..449227 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
PDI56_RS02420 (PDI56_02415)	comGC	449241..449552 (+)	312	WP_031786220.1	competence type IV pilus major pilin ComGC	Machinery gene
PDI56_RS02425 (PDI56_02420)	comGD	449530..449976 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
PDI56_RS02430 (PDI56_02425)	comGE	449963..450262 (+)	300	WP_000844410.1	hypothetical protein	Machinery gene
PDI56_RS02435 (PDI56_02430)	comGF	450180..450677 (+)	498	WP_001788897.1	competence type IV pilus minor pilin ComGF	Machinery gene
PDI56_RS02440 (PDI56_02435)	-	450774..450920 (+)	147	WP_001792109.1	hypothetical protein	-
PDI56_RS02445 (PDI56_02440)	-	450910..451434 (+)	525	WP_001015120.1	shikimate kinase	-
PDI56_RS02450 (PDI56_02445)	gcvT	451593..452684 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
PDI56_RS02455 (PDI56_02450)	gcvPA	452704..454050 (+)	1347	WP_000019691.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11297.32 Da
• Isoelectric Point: 8.5268

>NTDB_id=772259 PDI56_RS02420 WP_031786220.1 449241..449552(+) (comGC) [Staphylococcus aureus strain AF4004]
MFKFLKKTQAFTLIEILLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=772259 PDI56_RS02420 WP_031786220.1 449241..449552(+) (comGC) [Staphylococcus aureus strain AF4004]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATACTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus pneumoniae Rx1	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae D39	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae R6	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae TIGR4	45.098	99.029	0.447
comGC/cglC	Streptococcus mitis NCTC 12261	50	83.495	0.417
comGC/cglC	Streptococcus mitis SK321	50	83.495	0.417
comYC	Streptococcus gordonii str. Challis substr. CH1	41.837	95.146	0.398
comYC	Streptococcus suis isolate S10	48.718	75.728	0.369