Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | PYH51_RS07375 | Genome accession | NZ_CP118835 |
| Coordinates | 1552382..1552693 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain 7051 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1547382..1557693
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH51_RS07340 (PYH51_07345) | gcvPA | 1547884..1549230 (-) | 1347 | WP_045177127.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| PYH51_RS07345 (PYH51_07350) | gcvT | 1549250..1550341 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PYH51_RS07350 (PYH51_07355) | - | 1550500..1551024 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| PYH51_RS07355 (PYH51_07360) | - | 1551014..1551160 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| PYH51_RS07360 (PYH51_07365) | comGF | 1551257..1551754 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| PYH51_RS07365 (PYH51_07370) | comGE | 1551672..1551971 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| PYH51_RS07370 (PYH51_07375) | comGD | 1551958..1552404 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| PYH51_RS07375 (PYH51_07380) | comGC | 1552382..1552693 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PYH51_RS07380 (PYH51_07385) | comGB | 1552707..1553777 (-) | 1071 | WP_045176802.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| PYH51_RS07385 (PYH51_07390) | comGA | 1553749..1554723 (-) | 975 | Protein_1449 | competence type IV pilus ATPase ComGA | - |
| PYH51_RS07390 (PYH51_07395) | - | 1554775..1555398 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| PYH51_RS07395 (PYH51_07400) | - | 1555395..1555724 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| PYH51_RS07400 (PYH51_07405) | - | 1555724..1556710 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| PYH51_RS07405 (PYH51_07410) | - | 1556707..1556910 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=724005 PYH51_RS07375 WP_000472256.1 1552382..1552693(-) (comGC) [Staphylococcus aureus strain 7051]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=724005 PYH51_RS07375 WP_000472256.1 1552382..1552693(-) (comGC) [Staphylococcus aureus strain 7051]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |