Detailed information NTG0720377

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: NW981_RS07450
• Genome accession: NZ_CP102956
• Coordinates: 1562476..1562787 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 26-G-G
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1557476..1567787

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NW981_RS07415 (NW981_07415)	gcvPA	1557977..1559323 (-)	1347	WP_070973961.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
NW981_RS07420 (NW981_07420)	gcvT	1559343..1560434 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
NW981_RS07425 (NW981_07425)	-	1560594..1561118 (-)	525	WP_001015121.1	shikimate kinase	-
NW981_RS07430 (NW981_07430)	-	1561108..1561254 (-)	147	WP_001789879.1	hypothetical protein	-
NW981_RS07435 (NW981_07435)	comGF	1561351..1561848 (-)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
NW981_RS07440 (NW981_07440)	comGE	1561766..1562065 (-)	300	WP_000844409.1	hypothetical protein	Machinery gene
NW981_RS07445 (NW981_07445)	comGD	1562052..1562498 (-)	447	WP_258410042.1	competence type IV pilus minor pilin ComGD	Machinery gene
NW981_RS07450 (NW981_07450)	comGC	1562476..1562787 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
NW981_RS07455 (NW981_07455)	comGB	1562801..1563871 (-)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
NW981_RS07460 (NW981_07460)	comGA	1563843..1564817 (-)	975	WP_000697227.1	competence type IV pilus ATPase ComGA	Machinery gene
NW981_RS07465 (NW981_07465)	-	1564869..1565492 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
NW981_RS07470 (NW981_07470)	-	1565489..1565818 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
NW981_RS07475 (NW981_07475)	-	1565818..1566804 (-)	987	WP_258410043.1	ROK family glucokinase	-
NW981_RS07480 (NW981_07480)	-	1566801..1567004 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=720377 NW981_RS07450 WP_000472256.1 1562476..1562787(-) (comGC) [Staphylococcus aureus strain 26-G-G]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=720377 NW981_RS07450 WP_000472256.1 1562476..1562787(-) (comGC) [Staphylococcus aureus strain 26-G-G]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGTGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369