Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | NUU08_RS11420 | Genome accession | NZ_CP102522 |
| Coordinates | 2228354..2228623 (-) | Length | 89 a.a. |
| NCBI ID | WP_003129998.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain R-707-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2225363..2263406 | 2228354..2228623 | within | 0 |
Gene organization within MGE regions
Location: 2225363..2263406
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU08_RS11390 (NUU08_11380) | - | 2225363..2225800 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| NUU08_RS11395 (NUU08_11385) | - | 2226007..2226954 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| NUU08_RS11400 (NUU08_11390) | comGG | 2226928..2227254 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NUU08_RS11405 (NUU08_11395) | comGF | 2227304..2227732 (-) | 429 | Protein_2221 | competence type IV pilus minor pilin ComGF | - |
| NUU08_RS11410 (NUU08_11400) | comGE | 2227695..2227991 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| NUU08_RS11415 (NUU08_11405) | comGD | 2227963..2228394 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| NUU08_RS11420 (NUU08_11410) | comGC | 2228354..2228623 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| NUU08_RS11425 (NUU08_11415) | - | 2228750..2229496 (-) | 747 | WP_058221567.1 | hypothetical protein | - |
| NUU08_RS11430 (NUU08_11420) | - | 2229684..2230463 (-) | 780 | WP_082225220.1 | peptidoglycan amidohydrolase family protein | - |
| NUU08_RS11435 (NUU08_11425) | - | 2230463..2230762 (-) | 300 | WP_031559226.1 | phage holin | - |
| NUU08_RS11440 (NUU08_11430) | - | 2230775..2231125 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| NUU08_RS11445 (NUU08_11435) | - | 2231138..2231374 (-) | 237 | WP_082225257.1 | hypothetical protein | - |
| NUU08_RS11450 (NUU08_11440) | - | 2231386..2235651 (-) | 4266 | WP_243525488.1 | hypothetical protein | - |
| NUU08_RS11455 (NUU08_11445) | - | 2235630..2237159 (-) | 1530 | WP_003131327.1 | distal tail protein Dit | - |
| NUU08_RS11460 (NUU08_11450) | - | 2237169..2239778 (-) | 2610 | WP_058221395.1 | phage tail tape measure protein | - |
| NUU08_RS11465 (NUU08_11455) | - | 2239768..2240475 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| NUU08_RS11470 (NUU08_11460) | - | 2240491..2240898 (-) | 408 | WP_058221396.1 | hypothetical protein | - |
| NUU08_RS11475 (NUU08_11465) | - | 2240955..2241431 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| NUU08_RS11480 (NUU08_11470) | - | 2241442..2241876 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| NUU08_RS11485 (NUU08_11475) | - | 2241876..2242205 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| NUU08_RS11490 (NUU08_11480) | - | 2242202..2242546 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| NUU08_RS11495 (NUU08_11485) | - | 2242536..2242937 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| NUU08_RS11500 (NUU08_11490) | - | 2243011..2243247 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| NUU08_RS11505 (NUU08_11495) | - | 2243276..2244193 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| NUU08_RS11510 (NUU08_11500) | - | 2244208..2245257 (-) | 1050 | WP_003131314.1 | XkdF-like putative serine protease domain-containing protein | - |
| NUU08_RS11515 (NUU08_11505) | - | 2245273..2246103 (-) | 831 | WP_003131311.1 | phage minor head protein | - |
| NUU08_RS11520 (NUU08_11510) | - | 2246096..2247625 (-) | 1530 | WP_058221397.1 | phage portal protein | - |
| NUU08_RS11525 (NUU08_11515) | terL | 2247638..2249089 (-) | 1452 | WP_014570551.1 | phage terminase large subunit | - |
| NUU08_RS11530 (NUU08_11520) | - | 2249070..2249543 (-) | 474 | WP_058221398.1 | transposase | - |
| NUU08_RS11535 (NUU08_11525) | - | 2249715..2250104 (-) | 390 | WP_058221399.1 | DUF722 domain-containing protein | - |
| NUU08_RS11540 (NUU08_11530) | - | 2250181..2250489 (-) | 309 | WP_082225258.1 | hypothetical protein | - |
| NUU08_RS11545 (NUU08_11535) | - | 2250618..2250833 (-) | 216 | WP_058221541.1 | DUF1660 domain-containing protein | - |
| NUU08_RS11550 (NUU08_11540) | - | 2250830..2251048 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| NUU08_RS11555 (NUU08_11545) | - | 2251067..2251786 (-) | 720 | WP_082225259.1 | hypothetical protein | - |
| NUU08_RS11560 (NUU08_11550) | - | 2251813..2252172 (-) | 360 | WP_082225260.1 | hypothetical protein | - |
| NUU08_RS11565 (NUU08_11555) | dut | 2252176..2252595 (-) | 420 | WP_082225261.1 | dUTP diphosphatase | - |
| NUU08_RS11570 (NUU08_11560) | - | 2252592..2252957 (-) | 366 | WP_082225262.1 | DUF1642 domain-containing protein | - |
| NUU08_RS11575 (NUU08_11565) | - | 2252954..2253496 (-) | 543 | WP_145952586.1 | DUF1642 domain-containing protein | - |
| NUU08_RS11580 (NUU08_11570) | - | 2253489..2253647 (-) | 159 | WP_228763263.1 | hypothetical protein | - |
| NUU08_RS11585 (NUU08_11575) | - | 2253690..2253848 (-) | 159 | WP_228763273.1 | hypothetical protein | - |
| NUU08_RS11590 (NUU08_11580) | - | 2254040..2254246 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| NUU08_RS11595 (NUU08_11585) | - | 2254354..2254764 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| NUU08_RS11600 (NUU08_11590) | - | 2254777..2255133 (-) | 357 | WP_240354931.1 | L-rhamnose isomerase | - |
| NUU08_RS11605 (NUU08_11600) | - | 2255212..2256138 (-) | 927 | WP_058221710.1 | phage replisome organizer N-terminal domain-containing protein | - |
| NUU08_RS11610 (NUU08_11605) | - | 2256401..2257468 (-) | 1068 | WP_058221711.1 | DUF1351 domain-containing protein | - |
| NUU08_RS11615 (NUU08_11610) | bet | 2257470..2258207 (-) | 738 | WP_058212836.1 | phage recombination protein Bet | - |
| NUU08_RS11620 (NUU08_11615) | - | 2258314..2258490 (-) | 177 | WP_032943269.1 | putative transcriptional regulator | - |
| NUU08_RS11625 (NUU08_11620) | - | 2258487..2258735 (-) | 249 | WP_058221712.1 | hypothetical protein | - |
| NUU08_RS11630 (NUU08_11625) | - | 2258748..2258870 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| NUU08_RS11635 (NUU08_11630) | - | 2258867..2259049 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| NUU08_RS11640 (NUU08_11635) | - | 2259065..2259754 (-) | 690 | WP_058221713.1 | Rha family transcriptional regulator | - |
| NUU08_RS11645 (NUU08_11640) | - | 2259813..2260046 (-) | 234 | WP_014570819.1 | helix-turn-helix transcriptional regulator | - |
| NUU08_RS11650 (NUU08_11645) | - | 2260223..2260633 (+) | 411 | WP_014570820.1 | helix-turn-helix domain-containing protein | - |
| NUU08_RS11655 (NUU08_11650) | - | 2260644..2261228 (+) | 585 | WP_058221714.1 | hypothetical protein | - |
| NUU08_RS11660 (NUU08_11655) | - | 2261284..2261823 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| NUU08_RS11665 (NUU08_11660) | - | 2261949..2263406 (+) | 1458 | WP_058221720.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10123.56 Da Isoelectric Point: 4.2950
>NTDB_id=717465 NUU08_RS11420 WP_003129998.1 2228354..2228623(-) (comGC) [Lactococcus lactis strain R-707-1]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=717465 NUU08_RS11420 WP_003129998.1 2228354..2228623(-) (comGC) [Lactococcus lactis strain R-707-1]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
86.667 |
84.27 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.471 |
95.506 |
0.539 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
53.947 |
85.393 |
0.461 |
| comYC | Streptococcus mutans UA140 |
50.685 |
82.022 |
0.416 |
| comYC | Streptococcus mutans UA159 |
50.685 |
82.022 |
0.416 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
56.25 |
71.91 |
0.404 |