NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	NPS18_RS09105	Genome accession	NZ_CP101984
Coordinates	1843873..1844268 (-)	Length	131 a.a.
NCBI ID	WP_002263454.1	Uniprot ID	Q8DS68
Organism	Streptococcus mutans strain UA-159
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1838873..1849268

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NPS18_RS09080 (NPS18_09080)	-	1838923..1839126 (-)	204	WP_002279759.1	hypothetical protein	-
NPS18_RS09085 (NPS18_09085)	-	1839193..1840500 (-)	1308	WP_002263458.1	extracellular solute-binding protein	-
NPS18_RS09090 (NPS18_09090)	-	1840493..1841173 (-)	681	WP_002263457.1	response regulator transcription factor	-
NPS18_RS09095 (NPS18_09095)	-	1841173..1842495 (-)	1323	WP_002263456.1	sensor histidine kinase	-
NPS18_RS09100 (NPS18_09100)	-	1842495..1843457 (-)	963	WP_002263455.1	sugar ABC transporter substrate-binding protein	-
NPS18_RS09105 (NPS18_09105)	ssbA	1843873..1844268 (-)	396	WP_002263454.1	single-stranded DNA-binding protein	Machinery gene
NPS18_RS09110 (NPS18_09110)	-	1844355..1844711 (-)	357	WP_002263453.1	rhodanese-like domain-containing protein	-
NPS18_RS09115 (NPS18_09115)	-	1844711..1845142 (-)	432	WP_011074676.1	MarR family winged helix-turn-helix transcriptional regulator	-
NPS18_RS09120 (NPS18_09120)	ytpR	1845231..1845857 (-)	627	WP_002263451.1	YtpR family tRNA-binding protein	-
NPS18_RS09125 (NPS18_09125)	-	1845854..1846183 (-)	330	WP_002263450.1	thioredoxin family protein	-
NPS18_RS09130 (NPS18_09130)	-	1846161..1846469 (-)	309	WP_002263449.1	DUF4651 domain-containing protein	-
NPS18_RS09135 (NPS18_09135)	pepA	1846529..1847596 (+)	1068	WP_002263448.1	glutamyl aminopeptidase	-
NPS18_RS09140 (NPS18_09140)	proC	1847652..1848422 (+)	771	WP_002263447.1	pyrroline-5-carboxylate reductase	-
NPS18_RS09145 (NPS18_09145)	-	1848507..1849169 (-)	663	WP_002263446.1	type II CAAX endopeptidase family protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14841.90 Da Isoelectric Point: 6.4855

                                >NTDB_id=713527 NPS18_RS09105 WP_002263454.1 1843873..1844268(-) (ssbA) [Streptococcus mutans strain UA-159]

MYNKVILIGRLVATPEMVKTPKDKSVTRVTLAVNRRFKSQDGEKQADFVNVVLWGRLAETIASYGSKGSLISLDGELRTR

KYEKDGVTHFVTEVLGHSFQLLESRAQRAMRENNSENDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=713527 NPS18_RS09105 WP_002263454.1 1843873..1844268(-) (ssbA) [Streptococcus mutans strain UA-159]

ATGTATAATAAAGTTATTTTGATTGGTCGTTTAGTTGCGACACCTGAAATGGTAAAAACACCAAAGGATAAGTCTGTTAC

GCGCGTGACACTGGCTGTCAATCGGCGATTTAAAAGTCAAGATGGGGAAAAGCAGGCTGATTTTGTCAATGTTGTTCTTT

GGGGCAGATTGGCAGAAACAATAGCTTCCTATGGTAGTAAGGGAAGTCTCATCTCTCTTGATGGAGAATTGCGTACCCGT

AAATATGAAAAAGATGGCGTCACTCATTTTGTGACTGAAGTTTTGGGACACTCCTTTCAATTACTGGAAAGTCGTGCTCA

ACGTGCTATGCGTGAAAATAATTCTGAAAATGATTTGGCCGATTTGGTTCTAGAAGAGGAGGAACTCCCTTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q8DS68

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	100	100	1
ssbB	Streptococcus sobrinus strain NIDR 6715-7	78.626	100	0.786
ssbB/cilA	Streptococcus pneumoniae TIGR4	75.573	100	0.756
ssbB/cilA	Streptococcus pneumoniae Rx1	74.809	100	0.748
ssbB/cilA	Streptococcus pneumoniae D39	74.809	100	0.748
ssbB/cilA	Streptococcus pneumoniae R6	74.809	100	0.748
ssbB/cilA	Streptococcus mitis SK321	74.809	100	0.748
ssbB/cilA	Streptococcus mitis NCTC 12261	73.282	100	0.733
ssbB	Lactococcus lactis subsp. cremoris KW2	58.036	85.496	0.496
ssbA	Bacillus subtilis subsp. subtilis str. 168	50	80.916	0.405

Detailed information NTG0713527