NTDB

Overview

Name	comEA	Type	Machinery gene
Locus tag	NPA43_RS11590	Genome accession	NZ_CP101833
Coordinates	2281265..2281546 (-)	Length	93 a.a.
NCBI ID	WP_256498828.1	Uniprot ID	-
Organism	Bacillus pumilus strain NDY-10
Function	dsDNA binding to the cell surface (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2276265..2286546

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NPA43_RS11565 (NPA43_11565)	rpsT	2276477..2276743 (+)	267	WP_008342485.1	30S ribosomal protein S20	-
NPA43_RS11570 (NPA43_11570)	holA	2276879..2277898 (-)	1020	WP_256498825.1	DNA polymerase III subunit delta	-
NPA43_RS11575 (NPA43_11575)	-	2278136..2278270 (+)	135	WP_012010638.1	YqzM family protein	-
NPA43_RS11580 (NPA43_11580)	-	2278310..2280637 (-)	2328	WP_371930240.1	DNA internalization-related competence protein ComEC/Rec2	-
NPA43_RS11585 (NPA43_11585)	-	2280630..2281199 (-)	570	WP_024423045.1	ComE operon protein 2	-
NPA43_RS11590 (NPA43_11590)	comEA	2281265..2281546 (-)	282	WP_256498828.1	helix-hairpin-helix domain-containing protein	Machinery gene
NPA43_RS11595 (NPA43_11595)	-	2281629..2281895 (-)	267	WP_256498829.1	hypothetical protein	-
NPA43_RS11600 (NPA43_11600)	comER	2281986..2282834 (+)	849	WP_230030414.1	late competence protein ComER	-
NPA43_RS11605 (NPA43_11605)	-	2282883..2283626 (-)	744	WP_256498830.1	class I SAM-dependent methyltransferase	-
NPA43_RS11610 (NPA43_11610)	rsfS	2283623..2283979 (-)	357	WP_034319428.1	ribosome silencing factor	-
NPA43_RS11615 (NPA43_11615)	yqeK	2283993..2284556 (-)	564	WP_099726581.1	bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK	-
NPA43_RS11620 (NPA43_11620)	-	2284546..2285115 (-)	570	WP_256498831.1	nicotinate-nucleotide adenylyltransferase	-
NPA43_RS11625 (NPA43_11625)	yhbY	2285129..2285419 (-)	291	WP_008342507.1	ribosome assembly RNA-binding protein YhbY	-
NPA43_RS11630 (NPA43_11630)	aroE	2285413..2286255 (-)	843	WP_230030417.1	shikimate dehydrogenase	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10246.39 Da Isoelectric Point: 4.5173

                                >NTDB_id=712240 NPA43_RS11590 WP_256498828.1 2281265..2281546(-) (comEA) [Bacillus pumilus strain NDY-10]

MMIYVRKQGEAETQTQTSATDMSSGIEKSQGVNVNQADTAELQTINGIGPAKAEAIIAYREEHGEFEQIEDLRNISGFGE

KTVERLKSQLTVK

Nucleotide

Download Length: 282 bp

                                >NTDB_id=712240 NPA43_RS11590 WP_256498828.1 2281265..2281546(-) (comEA) [Bacillus pumilus strain NDY-10]

ATGATGATTTATGTTCGGAAGCAGGGAGAAGCGGAGACGCAGACGCAAACATCAGCAACTGACATGTCATCGGGGATTGA

AAAGAGTCAAGGTGTCAATGTCAATCAAGCTGATACAGCGGAATTGCAAACAATTAACGGAATCGGACCAGCCAAAGCAG

AAGCCATCATTGCCTATAGAGAGGAACATGGAGAATTTGAACAAATTGAAGATTTGCGGAACATTTCGGGTTTTGGGGAG

AAGACAGTCGAACGGCTGAAAAGTCAATTGACCGTGAAGTAG

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(28-91)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comEA	Latilactobacillus sakei subsp. sakei 23K	41.071	100	0.495
comEA	Bacillus subtilis subsp. subtilis str. 168	48.913	98.925	0.484
comEA	Lactococcus lactis subsp. cremoris KW2	42.708	100	0.441
comEA/celA/cilE	Streptococcus pneumoniae Rx1	38.462	97.849	0.376
comEA/celA/cilE	Streptococcus pneumoniae D39	38.462	97.849	0.376
comEA/celA/cilE	Streptococcus pneumoniae R6	38.462	97.849	0.376
comEA	Staphylococcus aureus MW2	37.634	100	0.376
comEA	Staphylococcus aureus N315	37.634	100	0.376
comEA/celA/cilE	Streptococcus pneumoniae TIGR4	37.363	97.849	0.366
comEA/celA/cilE	Streptococcus mitis NCTC 12261	37.363	97.849	0.366
comEA	Vibrio campbellii strain DS40M4	40	91.398	0.366

Detailed information NTG0712240