Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | PCM89_RS07745 | Genome accession | NZ_CP115887 |
| Coordinates | 1617143..1617454 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain C308 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1612143..1622454
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCM89_RS07710 (PCM89_07710) | gcvPA | 1612645..1613991 (-) | 1347 | WP_000019688.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| PCM89_RS07715 (PCM89_07715) | gcvT | 1614011..1615102 (-) | 1092 | WP_000093355.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PCM89_RS07720 (PCM89_07720) | - | 1615261..1615785 (-) | 525 | WP_001015122.1 | shikimate kinase | - |
| PCM89_RS07725 (PCM89_07725) | - | 1615775..1615921 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| PCM89_RS07730 (PCM89_07730) | comGF | 1616018..1616515 (-) | 498 | WP_029697681.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| PCM89_RS07735 (PCM89_07735) | comGE | 1616433..1616732 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| PCM89_RS07740 (PCM89_07740) | comGD | 1616719..1617165 (-) | 447 | WP_075583651.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| PCM89_RS07745 (PCM89_07745) | comGC | 1617143..1617454 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PCM89_RS07750 (PCM89_07750) | comGB | 1617468..1618538 (-) | 1071 | WP_000776403.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| PCM89_RS07755 (PCM89_07755) | comGA | 1618510..1619484 (-) | 975 | WP_000697215.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| PCM89_RS07760 (PCM89_07760) | - | 1619536..1620159 (-) | 624 | WP_001223006.1 | MBL fold metallo-hydrolase | - |
| PCM89_RS07765 (PCM89_07765) | - | 1620156..1620485 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| PCM89_RS07770 (PCM89_07770) | - | 1620485..1621471 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| PCM89_RS07775 (PCM89_07775) | - | 1621468..1621671 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=706173 PCM89_RS07745 WP_000472256.1 1617143..1617454(-) (comGC) [Staphylococcus aureus strain C308]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=706173 PCM89_RS07745 WP_000472256.1 1617143..1617454(-) (comGC) [Staphylococcus aureus strain C308]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |