Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LPT18_RS02275 | Genome accession | NZ_CP099508 |
| Coordinates | 426922..427233 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain S82 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 421922..432233
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT18_RS02245 (LPT18_02245) | - | 422705..422908 (+) | 204 | WP_000087559.1 | YqgQ family protein | - |
| LPT18_RS02250 (LPT18_02250) | - | 422905..423891 (+) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| LPT18_RS02255 (LPT18_02255) | - | 423891..424220 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| LPT18_RS02260 (LPT18_02260) | - | 424217..424840 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| LPT18_RS02265 (LPT18_02265) | comGA | 424892..425866 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LPT18_RS02270 (LPT18_02270) | comGB | 425838..426908 (+) | 1071 | WP_000776425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LPT18_RS02275 (LPT18_02275) | comGC | 426922..427233 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LPT18_RS02280 (LPT18_02280) | comGD | 427211..427657 (+) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LPT18_RS02285 (LPT18_02285) | comGE | 427644..427943 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| LPT18_RS02290 (LPT18_02290) | comGF | 427861..428358 (+) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LPT18_RS02295 (LPT18_02295) | - | 428455..428601 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| LPT18_RS02300 (LPT18_02300) | - | 428591..429115 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| LPT18_RS02305 (LPT18_02305) | gcvT | 429274..430365 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LPT18_RS02310 (LPT18_02310) | gcvPA | 430385..431731 (+) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=700273 LPT18_RS02275 WP_000472256.1 426922..427233(+) (comGC) [Staphylococcus aureus strain S82]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=700273 LPT18_RS02275 WP_000472256.1 426922..427233(+) (comGC) [Staphylococcus aureus strain S82]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |