Detailed information NTG0693354

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: NAA64_RS06710
• Genome accession: NZ_CP097887
• Coordinates: 1383825..1384133 (+)
• Length: 102 a.a.
• NCBI ID: WP_103387866.1
• Uniprot ID: -
• Organism: Staphylococcus arlettae strain SA283
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1378825..1389133

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NAA64_RS06680 (NAA64_06680)	-	1379153..1379347 (+)	195	WP_002509763.1	YqgQ family protein	-
NAA64_RS06685 (NAA64_06685)	-	1379814..1380800 (+)	987	WP_002509762.1	glucokinase	-
NAA64_RS06690 (NAA64_06690)	-	1380800..1381138 (+)	339	WP_002509761.1	MTH1187 family thiamine-binding protein	-
NAA64_RS06695 (NAA64_06695)	-	1381125..1381742 (+)	618	WP_002509760.1	MBL fold metallo-hydrolase	-
NAA64_RS06700 (NAA64_06700)	comGA	1381795..1382769 (+)	975	WP_002509759.1	competence type IV pilus ATPase ComGA	Machinery gene
NAA64_RS06705 (NAA64_06705)	comGB	1382741..1383793 (+)	1053	WP_103387865.1	competence type IV pilus assembly protein ComGB	-
NAA64_RS06710 (NAA64_06710)	comGC	1383825..1384133 (+)	309	WP_103387866.1	competence type IV pilus major pilin ComGC	Machinery gene
NAA64_RS06715 (NAA64_06715)	comGD	1384123..1384560 (+)	438	WP_245300840.1	competence type IV pilus minor pilin ComGD	-
NAA64_RS06720 (NAA64_06720)	-	1384541..1384840 (+)	300	WP_002509755.1	hypothetical protein	-
NAA64_RS06725 (NAA64_06725)	-	1384815..1385243 (+)	429	WP_103387868.1	ComGF family competence protein	-
NAA64_RS06730 (NAA64_06730)	-	1385411..1385923 (+)	513	WP_002509752.1	shikimate kinase	-
NAA64_RS06735 (NAA64_06735)	gcvT	1386091..1387182 (+)	1092	WP_021459931.1	glycine cleavage system aminomethyltransferase GcvT	-
NAA64_RS06740 (NAA64_06740)	gcvPA	1387201..1388553 (+)	1353	WP_002509750.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 102 a.a.
• Molecular weight: 11303.35 Da
• Isoelectric Point: 9.5423

>NTDB_id=693354 NAA64_RS06710 WP_103387866.1 1383825..1384133(+) (comGC) [Staphylococcus arlettae strain SA283]
MYKRTVTKAFTLIEMLLVLLIISLLLILIIPNIAKQSKHIQNTGCKAQLKMVDSQIEAYTLKNNQAPATIDDLVREGYIK
ENQKQCKSGANITITNGEAVAS

Nucleotide

• Length: 309 bp

>NTDB_id=693354 NAA64_RS06710 WP_103387866.1 1383825..1384133(+) (comGC) [Staphylococcus arlettae strain SA283]
ATGTATAAAAGAACTGTTACAAAAGCTTTTACATTAATAGAAATGTTACTCGTACTATTAATCATTAGTTTATTACTCAT
ACTAATAATCCCTAATATTGCAAAACAATCAAAGCATATACAAAATACAGGTTGTAAAGCACAATTAAAAATGGTCGATA
GCCAAATAGAAGCATACACATTAAAAAATAATCAAGCACCAGCAACAATAGATGACCTTGTTCGAGAGGGGTATATTAAA
GAGAATCAAAAACAATGTAAATCCGGTGCAAATATTACAATTACTAATGGTGAAGCTGTTGCTAGCTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	75	94.118	0.706
comGC	Staphylococcus aureus MW2	75	94.118	0.706
comYC	Streptococcus gordonii str. Challis substr. CH1	50	84.314	0.422
comYC	Streptococcus mutans UA140	50.617	79.412	0.402
comYC	Streptococcus mutans UA159	50.617	79.412	0.402
comGC	Bacillus subtilis subsp. subtilis str. 168	43.956	89.216	0.392
comYC	Streptococcus suis isolate S10	51.316	74.51	0.382
comGC/cglC	Streptococcus mitis NCTC 12261	46.914	79.412	0.373
comGC/cglC	Streptococcus mitis SK321	45.238	82.353	0.373
comGC/cglC	Streptococcus pneumoniae R6	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae D39	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae Rx1	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae TIGR4	44.048	82.353	0.363