Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | C820_RS08995 | Genome accession | NZ_CP097810 |
| Coordinates | 1793617..1793994 (+) | Length | 125 a.a. |
| NCBI ID | WP_004034628.1 | Uniprot ID | N1ZLD0 |
| Organism | Clostridium sp. MD294 strain ASF356 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1779178..1820459 | 1793617..1793994 | within | 0 |
Gene organization within MGE regions
Location: 1779178..1820459
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C820_RS08835 (C820_001758) | - | 1779178..1780356 (-) | 1179 | WP_004034665.1 | tyrosine-type recombinase/integrase | - |
| C820_RS08840 (C820_001759) | - | 1780503..1781342 (-) | 840 | WP_004034664.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| C820_RS08845 (C820_001760) | - | 1781422..1782411 (-) | 990 | WP_004034663.1 | replication protein | - |
| C820_RS08850 (C820_001761) | - | 1782746..1783222 (-) | 477 | WP_004034662.1 | helix-turn-helix domain-containing protein | - |
| C820_RS08855 (C820_001762) | - | 1783395..1783601 (+) | 207 | WP_004034661.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS08860 (C820_001763) | - | 1783670..1783879 (-) | 210 | WP_004034660.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| C820_RS08865 (C820_001764) | - | 1783872..1784132 (-) | 261 | WP_004034659.1 | hypothetical protein | - |
| C820_RS08870 (C820_001765) | - | 1784161..1784388 (-) | 228 | WP_004034658.1 | hypothetical protein | - |
| C820_RS08875 (C820_001766) | - | 1784633..1784851 (-) | 219 | WP_004034657.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS08880 (C820_001767) | - | 1784994..1785182 (+) | 189 | WP_004034656.1 | hypothetical protein | - |
| C820_RS08885 (C820_001768) | - | 1785179..1785400 (+) | 222 | WP_004034655.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS08890 (C820_001769) | - | 1785442..1785612 (+) | 171 | WP_004034654.1 | hypothetical protein | - |
| C820_RS08895 | - | 1785578..1785961 (-) | 384 | WP_083863683.1 | DUF2513 domain-containing protein | - |
| C820_RS08900 (C820_001770) | - | 1786139..1786321 (+) | 183 | WP_004034653.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS08905 (C820_001771) | - | 1786405..1786818 (+) | 414 | WP_004034652.1 | hypothetical protein | - |
| C820_RS08910 (C820_001772) | - | 1787022..1787249 (+) | 228 | WP_004034651.1 | hypothetical protein | - |
| C820_RS08915 (C820_001773) | - | 1787343..1787615 (+) | 273 | WP_004034650.1 | Veg family protein | - |
| C820_RS08920 (C820_001774) | - | 1787739..1788020 (+) | 282 | WP_004034649.1 | hypothetical protein | - |
| C820_RS08925 (C820_001775) | - | 1788017..1788310 (+) | 294 | WP_004034648.1 | Rha family transcriptional regulator | - |
| C820_RS08930 (C820_001776) | - | 1788320..1788694 (+) | 375 | WP_004034647.1 | hypothetical protein | - |
| C820_RS08935 (C820_001777) | - | 1788747..1789010 (-) | 264 | WP_004034646.1 | Txe/YoeB family addiction module toxin | - |
| C820_RS08940 (C820_001778) | - | 1789007..1789270 (-) | 264 | WP_004034644.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| C820_RS08945 (C820_001779) | - | 1789351..1789581 (-) | 231 | WP_004034642.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS14475 | - | 1789723..1789848 (+) | 126 | WP_279282464.1 | hypothetical protein | - |
| C820_RS08950 (C820_001781) | - | 1790040..1790237 (+) | 198 | WP_004034639.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS08955 (C820_001782) | - | 1790296..1790526 (-) | 231 | WP_004034638.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS08960 (C820_001783) | - | 1790811..1791050 (-) | 240 | WP_004034637.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS14480 | - | 1791212..1791334 (+) | 123 | WP_279282463.1 | hypothetical protein | - |
| C820_RS08965 (C820_001784) | - | 1791527..1791754 (+) | 228 | WP_004034634.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS08970 (C820_001785) | - | 1791767..1791952 (+) | 186 | WP_156801391.1 | hypothetical protein | - |
| C820_RS08975 (C820_001786) | - | 1791949..1792125 (+) | 177 | WP_004034632.1 | hypothetical protein | - |
| C820_RS08980 (C820_001787) | - | 1792212..1792712 (+) | 501 | WP_004034631.1 | siphovirus Gp157 family protein | - |
| C820_RS08985 (C820_001788) | - | 1792727..1793071 (+) | 345 | WP_004034630.1 | hypothetical protein | - |
| C820_RS08990 (C820_001789) | - | 1793046..1793624 (+) | 579 | WP_004034629.1 | ERF family protein | - |
| C820_RS08995 (C820_001790) | ssbA | 1793617..1793994 (+) | 378 | WP_004034628.1 | single-stranded DNA-binding protein | Machinery gene |
| C820_RS09000 (C820_001791) | - | 1794136..1795011 (+) | 876 | WP_004034627.1 | hypothetical protein | - |
| C820_RS09005 (C820_001792) | - | 1795008..1795703 (+) | 696 | WP_004034624.1 | replicative helicase loader/inhibitor | - |
| C820_RS09010 (C820_001793) | - | 1795887..1796159 (+) | 273 | WP_004034623.1 | hypothetical protein | - |
| C820_RS09015 (C820_001794) | - | 1796336..1796749 (+) | 414 | WP_004034622.1 | hypothetical protein | - |
| C820_RS09020 (C820_001795) | - | 1797007..1797660 (+) | 654 | WP_004034621.1 | helix-turn-helix domain-containing protein | - |
| C820_RS09025 (C820_001796) | terL | 1797662..1799092 (+) | 1431 | WP_004034619.1 | phage terminase large subunit | - |
| C820_RS09030 (C820_001797) | - | 1799114..1800376 (+) | 1263 | WP_251855591.1 | DUF935 domain-containing protein | - |
| C820_RS09035 (C820_001798) | - | 1800380..1801918 (+) | 1539 | WP_004034615.1 | phage minor head protein | - |
| C820_RS09040 (C820_001799) | - | 1801915..1802184 (+) | 270 | WP_004034613.1 | hypothetical protein | - |
| C820_RS09045 (C820_001800) | - | 1802347..1802982 (+) | 636 | WP_004034611.1 | hypothetical protein | - |
| C820_RS09050 (C820_001801) | - | 1802986..1803228 (+) | 243 | WP_004034610.1 | hypothetical protein | - |
| C820_RS09055 (C820_001803) | - | 1803492..1803674 (+) | 183 | WP_004034608.1 | hypothetical protein | - |
| C820_RS09060 (C820_001804) | - | 1803763..1804203 (+) | 441 | WP_004034607.1 | XkdF-like putative serine protease domain-containing protein | - |
| C820_RS14485 (C820_001805) | - | 1804283..1804405 (+) | 123 | WP_004034606.1 | hypothetical protein | - |
| C820_RS09065 (C820_001806) | - | 1804600..1805493 (+) | 894 | WP_004034605.1 | hypothetical protein | - |
| C820_RS09070 (C820_001807) | - | 1805543..1806220 (+) | 678 | WP_004034604.1 | LysM peptidoglycan-binding domain-containing protein | - |
| C820_RS09075 (C820_001808) | - | 1806234..1807217 (+) | 984 | WP_004034603.1 | hypothetical protein | - |
| C820_RS09080 (C820_001809) | - | 1807214..1807720 (+) | 507 | WP_004034602.1 | hypothetical protein | - |
| C820_RS09085 (C820_001810) | - | 1807713..1808162 (+) | 450 | WP_004034601.1 | DUF2634 domain-containing protein | - |
| C820_RS09090 (C820_001811) | - | 1808232..1808402 (+) | 171 | WP_004034600.1 | type II toxin-antitoxin system HicA family toxin | - |
| C820_RS09095 (C820_001812) | - | 1808457..1808870 (+) | 414 | WP_004034599.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| C820_RS09100 (C820_001813) | - | 1808936..1809352 (+) | 417 | WP_004034598.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| C820_RS09105 (C820_001814) | - | 1809410..1810528 (+) | 1119 | WP_004034597.1 | baseplate J/gp47 family protein | - |
| C820_RS09110 (C820_001815) | - | 1810525..1811265 (+) | 741 | WP_004034596.1 | putative phage tail protein | - |
| C820_RS09115 (C820_001816) | - | 1811773..1813665 (+) | 1893 | WP_162213044.1 | hypothetical protein | - |
| C820_RS09120 (C820_001817) | - | 1813628..1815091 (+) | 1464 | WP_004034594.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| C820_RS09125 (C820_001818) | - | 1815104..1815865 (+) | 762 | WP_004034593.1 | hypothetical protein | - |
| C820_RS09130 (C820_001819) | - | 1815920..1816138 (-) | 219 | WP_004034592.1 | helix-turn-helix transcriptional regulator | - |
| C820_RS09135 (C820_001820) | - | 1816131..1816394 (-) | 264 | WP_004034591.1 | DUF2442 domain-containing protein | - |
| C820_RS09140 (C820_001821) | - | 1816438..1816698 (-) | 261 | WP_004034590.1 | DUF4160 domain-containing protein | - |
| C820_RS09145 (C820_001822) | - | 1816873..1818657 (+) | 1785 | WP_004034589.1 | fibronectin type III domain-containing protein | - |
| C820_RS09150 (C820_001823) | - | 1818654..1818842 (+) | 189 | WP_004034588.1 | hypothetical protein | - |
| C820_RS09155 (C820_001824) | - | 1818835..1818987 (+) | 153 | WP_004034587.1 | XkdX family protein | - |
| C820_RS09160 (C820_001825) | - | 1819088..1819342 (+) | 255 | WP_004034586.1 | hypothetical protein | - |
| C820_RS09165 (C820_001826) | - | 1819344..1819607 (+) | 264 | WP_004034585.1 | phage holin | - |
| C820_RS09170 (C820_001827) | - | 1819617..1820459 (+) | 843 | WP_004034584.1 | peptidoglycan recognition family protein | - |
Sequence
Protein
Download Length: 125 a.a. Molecular weight: 14375.19 Da Isoelectric Point: 7.9488
>NTDB_id=692783 C820_RS08995 WP_004034628.1 1793617..1793994(+) (ssbA) [Clostridium sp. MD294 strain ASF356]
MNKVILMGRLTKKPEVKYTQQNVAVARYTLAVARRFQQKGQSEVDFINCITFGKSAEFAQKYLNKGKQIAIVGKIQVRSW
ENENSQKQWSTEVIVEEQYFADSKVNETEGNSFNTVEQSDDDLPF
MNKVILMGRLTKKPEVKYTQQNVAVARYTLAVARRFQQKGQSEVDFINCITFGKSAEFAQKYLNKGKQIAIVGKIQVRSW
ENENSQKQWSTEVIVEEQYFADSKVNETEGNSFNTVEQSDDDLPF
Nucleotide
Download Length: 378 bp
>NTDB_id=692783 C820_RS08995 WP_004034628.1 1793617..1793994(+) (ssbA) [Clostridium sp. MD294 strain ASF356]
ATGAATAAAGTGATATTGATGGGAAGATTGACAAAAAAACCAGAAGTAAAATATACACAGCAAAATGTAGCAGTTGCAAG
GTATACCCTTGCAGTTGCTAGAAGATTTCAGCAAAAAGGACAATCAGAAGTAGATTTTATAAATTGTATTACTTTTGGAA
AATCAGCAGAGTTTGCACAAAAGTATCTAAATAAAGGCAAACAGATAGCAATTGTAGGAAAAATACAAGTGCGTTCGTGG
GAAAATGAAAATAGTCAAAAGCAATGGAGTACAGAGGTGATTGTAGAAGAACAGTACTTTGCAGATAGTAAAGTAAATGA
AACAGAAGGAAATAGTTTTAATACAGTAGAACAAAGTGATGATGATTTACCATTTTAA
ATGAATAAAGTGATATTGATGGGAAGATTGACAAAAAAACCAGAAGTAAAATATACACAGCAAAATGTAGCAGTTGCAAG
GTATACCCTTGCAGTTGCTAGAAGATTTCAGCAAAAAGGACAATCAGAAGTAGATTTTATAAATTGTATTACTTTTGGAA
AATCAGCAGAGTTTGCACAAAAGTATCTAAATAAAGGCAAACAGATAGCAATTGTAGGAAAAATACAAGTGCGTTCGTGG
GAAAATGAAAATAGTCAAAAGCAATGGAGTACAGAGGTGATTGTAGAAGAACAGTACTTTGCAGATAGTAAAGTAAATGA
AACAGAAGGAAATAGTTTTAATACAGTAGAACAAAGTGATGATGATTTACCATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
35.673 |
100 |
0.488 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.154 |
100 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.154 |
100 |
0.376 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
36.154 |
100 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
35.385 |
100 |
0.368 |
| ssbA | Streptococcus mutans UA159 |
35.385 |
100 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
35.385 |
100 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
35.385 |
100 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
35.385 |
100 |
0.368 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
42.991 |
85.6 |
0.368 |