Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | STO1_RS00030 | Genome accession | NZ_AP018338 |
| Coordinates | 4686..4808 (+) | Length | 40 a.a. |
| NCBI ID | WP_007520968.1 | Uniprot ID | A0A0F2DVB4 |
| Organism | Streptococcus oralis subsp. tigurinus strain osk_001 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1..9808
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STO1_RS00005 (STO1_000010) | dnaA | 154..1515 (-) | 1362 | WP_007520973.1 | chromosomal replication initiator protein DnaA | - |
| STO1_RS00010 (STO1_000020) | spo0J | 1732..2490 (-) | 759 | WP_045618162.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| STO1_RS00015 (STO1_000030) | htrA | 2548..3738 (-) | 1191 | WP_007520971.1 | S1C family serine protease | Regulator |
| STO1_RS00020 (STO1_000040) | rlmH | 3924..4403 (+) | 480 | WP_007520969.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| STO1_RS00030 (STO1_000050) | comC | 4686..4808 (+) | 123 | WP_007520968.1 | competence-stimulating peptide ComC | Regulator |
| STO1_RS00035 (STO1_000060) | comD | 4821..6140 (+) | 1320 | WP_007520967.1 | competence system sensor histidine kinase ComD | Regulator |
| STO1_RS00040 (STO1_000070) | comE | 6137..6889 (+) | 753 | WP_000866082.1 | competence system response regulator transcription factor ComE | Regulator |
| STO1_RS00055 (STO1_000080) | - | 7130..7672 (-) | 543 | WP_007520966.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4939.71 Da Isoelectric Point: 9.8677
>NTDB_id=69024 STO1_RS00030 WP_007520968.1 4686..4808(+) (comC) [Streptococcus oralis subsp. tigurinus strain osk_001]
MKNTVKLEQFKEVTEAELQEIRGGEIRKENNFLFYFFKRK
MKNTVKLEQFKEVTEAELQEIRGGEIRKENNFLFYFFKRK
Nucleotide
Download Length: 123 bp
>NTDB_id=69024 STO1_RS00030 WP_007520968.1 4686..4808(+) (comC) [Streptococcus oralis subsp. tigurinus strain osk_001]
ATGAAAAATACAGTAAAATTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGAAATTAG
AAAGGAAAATAATTTTTTATTTTATTTTTTTAAAAGAAAGTAA
ATGAAAAATACAGTAAAATTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGAAATTAG
AAAGGAAAATAATTTTTTATTTTATTTTTTTAAAAGAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
100 |
0.575 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
55 |
100 |
0.55 |
| comC/comC2 | Streptococcus pneumoniae A66 |
55 |
100 |
0.55 |
| comC | Streptococcus mitis SK321 |
55 |
100 |
0.55 |
| comC/comC1 | Streptococcus pneumoniae G54 |
52.5 |
100 |
0.525 |
| comC/comC1 | Streptococcus pneumoniae R6 |
52.5 |
100 |
0.525 |
| comC/comC1 | Streptococcus pneumoniae D39 |
52.5 |
100 |
0.525 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
52.5 |
100 |
0.525 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
92.5 |
0.4 |