Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | M1E50_RS02375 | Genome accession | NZ_CP096274 |
| Coordinates | 445996..446307 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain FJ0322 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 440996..451307
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1E50_RS02345 (M1E50_02340) | - | 441779..441982 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| M1E50_RS02350 (M1E50_02345) | - | 441979..442965 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| M1E50_RS02355 (M1E50_02350) | - | 442965..443294 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| M1E50_RS02360 (M1E50_02355) | - | 443291..443914 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| M1E50_RS02365 (M1E50_02360) | comGA | 443966..444940 (+) | 975 | WP_000697217.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| M1E50_RS02370 (M1E50_02365) | comGB | 444912..445982 (+) | 1071 | WP_064131344.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| M1E50_RS02375 (M1E50_02370) | comGC | 445996..446307 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| M1E50_RS02380 (M1E50_02375) | comGD | 446285..446731 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| M1E50_RS02385 (M1E50_02380) | comGE | 446718..447017 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| M1E50_RS02390 (M1E50_02385) | comGF | 446935..447432 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| M1E50_RS02395 (M1E50_02390) | - | 447529..447675 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| M1E50_RS02400 (M1E50_02395) | - | 447665..448189 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| M1E50_RS02405 (M1E50_02400) | gcvT | 448348..449439 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| M1E50_RS02410 (M1E50_02405) | gcvPA | 449459..450805 (+) | 1347 | WP_000019692.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=680824 M1E50_RS02375 WP_000472256.1 445996..446307(+) (comGC) [Staphylococcus aureus strain FJ0322]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=680824 M1E50_RS02375 WP_000472256.1 445996..446307(+) (comGC) [Staphylococcus aureus strain FJ0322]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |