Detailed information NTG0673479

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA21_RS06470
• Genome accession: NZ_CP094825
• Coordinates: 1317952..1318260 (-)
• Length: 102 a.a.
• NCBI ID: WP_164987268.1
• Uniprot ID: -
• Organism: Staphylococcus ureilyticus strain IVB6236
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1312952..1323260

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA21_RS06440 (MUA21_06410)	gcvPA	1313520..1314872 (-)	1353	WP_107526324.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
MUA21_RS06445 (MUA21_06415)	gcvT	1314890..1315981 (-)	1092	WP_107526325.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA21_RS06450 (MUA21_06420)	-	1316138..1316662 (-)	525	WP_046208175.1	shikimate kinase	-
MUA21_RS06455 (MUA21_06425)	-	1316827..1317270 (-)	444	WP_336606224.1	ComGF family competence protein	-
MUA21_RS06460 (MUA21_06430)	-	1317248..1317541 (-)	294	WP_046208172.1	hypothetical protein	-
MUA21_RS06465 (MUA21_06435)	comGD	1317522..1317962 (-)	441	WP_103161487.1	competence type IV pilus minor pilin ComGD	-
MUA21_RS06470 (MUA21_06440)	comGC	1317952..1318260 (-)	309	WP_164987268.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA21_RS06475 (MUA21_06445)	comGB	1318289..1319356 (-)	1068	WP_262562207.1	competence type IV pilus assembly protein ComGB	-
MUA21_RS06480 (MUA21_06450)	comGA	1319328..1320302 (-)	975	WP_064208910.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA21_RS06485 (MUA21_06455)	-	1320362..1320985 (-)	624	WP_046208168.1	MBL fold metallo-hydrolase	-
MUA21_RS06490 (MUA21_06460)	-	1320988..1321311 (-)	324	WP_064208909.1	MTH1187 family thiamine-binding protein	-
MUA21_RS06495 (MUA21_06465)	-	1321311..1322297 (-)	987	WP_107526330.1	glucokinase	-
MUA21_RS06500 (MUA21_06470)	-	1322604..1322804 (-)	201	WP_262562246.1	YqgQ family protein	-

Sequence

Protein

• Length: 102 a.a.
• Molecular weight: 11415.43 Da
• Isoelectric Point: 8.5074

>NTDB_id=673479 MUA21_RS06470 WP_164987268.1 1317952..1318260(-) (comGC) [Staphylococcus ureilyticus strain IVB6236]
MKQFFNKRAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQSTGCDAQIKMIESQVEAYTLKHNKKPQSIDELIADGYIK
ENQKNCKSGATITINNGEVIAN

Nucleotide

• Length: 309 bp

>NTDB_id=673479 MUA21_RS06470 WP_164987268.1 1317952..1318260(-) (comGC) [Staphylococcus ureilyticus strain IVB6236]
ATAAAACAATTTTTTAATAAACGTGCTTTTACTTTAATTGAGATGCTCCTCGTGCTTTTAATTATCAGTTTATTACTGAT
ATTGATTATACCCAATATTGCAAAACAATCTTCACATATTCAAAGTACAGGTTGTGATGCCCAAATAAAAATGATTGAAA
GTCAAGTTGAAGCATATACTTTAAAACATAATAAAAAACCACAATCTATAGATGAATTGATTGCGGATGGCTATATTAAA
GAAAACCAAAAAAATTGTAAATCAGGTGCTACTATCACAATTAACAATGGTGAAGTAATTGCAAACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-29)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	74.757	100	0.755
comGC	Staphylococcus aureus MW2	74.757	100	0.755
comGC/cglC	Streptococcus mitis NCTC 12261	42.105	93.137	0.392
comGC	Bacillus subtilis subsp. subtilis str. 168	41.053	93.137	0.382
comGC/cglC	Streptococcus mitis SK321	50	74.51	0.373
comYC	Streptococcus mutans UA159	48.101	77.451	0.373
comYC	Streptococcus mutans UA140	48.101	77.451	0.373
comGC/cglC	Streptococcus pneumoniae R6	48.684	74.51	0.363
comGC/cglC	Streptococcus pneumoniae D39	48.684	74.51	0.363
comGC/cglC	Streptococcus pneumoniae Rx1	48.684	74.51	0.363
comGC/cglC	Streptococcus pneumoniae TIGR4	48.684	74.51	0.363
comYC	Streptococcus suis isolate S10	48.684	74.51	0.363