Detailed information NTG0673414

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA76_RS07420
• Genome accession: NZ_CP094823
• Coordinates: 1480929..1481246 (+)
• Length: 105 a.a.
• NCBI ID: WP_049318779.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain IVB6217
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1475929..1486246

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA76_RS07380 (MUA76_07370)	-	1476074..1476265 (+)	192	WP_144412545.1	YqgQ family protein	-
MUA76_RS07385 (MUA76_07375)	-	1476262..1477233 (+)	972	WP_025904167.1	ROK family glucokinase	-
MUA76_RS07390 (MUA76_07380)	-	1477233..1477547 (+)	315	WP_037588286.1	MTH1187 family thiamine-binding protein	-
MUA76_RS07395 (MUA76_07385)	-	1477577..1477816 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
MUA76_RS07400 (MUA76_07390)	-	1477914..1478546 (+)	633	WP_049318777.1	MBL fold metallo-hydrolase	-
MUA76_RS07405 (MUA76_07395)	-	1478579..1478827 (-)	249	WP_025904960.1	DUF2626 family protein	-
MUA76_RS07410 (MUA76_07400)	comGA	1478981..1479883 (+)	903	WP_262650670.1	competence type IV pilus ATPase ComGA	-
MUA76_RS07415 (MUA76_07405)	comGB	1479873..1480913 (+)	1041	WP_262650671.1	competence type IV pilus assembly protein ComGB	-
MUA76_RS07420 (MUA76_07410)	comGC	1480929..1481246 (+)	318	WP_049318779.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA76_RS07425 (MUA76_07415)	-	1481284..1481550 (+)	267	WP_394802378.1	hypothetical protein	-
MUA76_RS07430 (MUA76_07420)	-	1481606..1481938 (+)	333	WP_262650672.1	hypothetical protein	-
MUA76_RS07435 (MUA76_07425)	-	1481913..1482347 (+)	435	WP_049318781.1	competence type IV pilus minor pilin ComGF	-
MUA76_RS07440 (MUA76_07430)	-	1482578..1483066 (+)	489	WP_037588260.1	shikimate kinase	-
MUA76_RS07445 (MUA76_07435)	gcvT	1483259..1484347 (+)	1089	WP_049318783.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA76_RS07450 (MUA76_07440)	gcvPA	1484359..1485702 (+)	1344	WP_262650673.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11591.60 Da
• Isoelectric Point: 7.8554

>NTDB_id=673414 MUA76_RS07420 WP_049318779.1 1480929..1481246(+) (comGC) [Mammaliicoccus sciuri strain IVB6217]
MKRFNFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLISDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=673414 MUA76_RS07420 WP_049318779.1 1480929..1481246(+) (comGC) [Mammaliicoccus sciuri strain IVB6217]
ATGAAAAGATTTAATTTTTTAAGTAAAAAAGAAGGGTTTACATTGGTTGAGATGTTAATTGTTCTTTTAATAATAAGTAT
ATTATTGGTGATCATCATACCAAACATTAGCAAGCAATCAGAGACTGTAAAAAGTACTGGCTGCCAAGCTCAAGTGAAAA
TGGTTGCTGGTCAAGTAGAAGCTTATACATTGAAACACGATGCTAAACCAAATTCTATAAATGATTTAATAAGTGATGGC
TATATTAACCAAAAGCAACTGACTTGTAAATCAGGAGAAACAATTACGCTAGAAAACGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA159	47.126	82.857	0.39
comYC	Streptococcus mutans UA140	47.126	82.857	0.39
comGC/cglC	Streptococcus mitis SK321	45.977	82.857	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	45.977	82.857	0.381
comGC/cglC	Streptococcus pneumoniae D39	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae Rx1	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae TIGR4	44.828	82.857	0.371
comGC/cglC	Streptococcus pneumoniae R6	44.828	82.857	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362