Detailed information NTG0673047

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA97_RS06225
• Genome accession: NZ_CP094811
• Coordinates: 1272206..1272517 (+)
• Length: 103 a.a.
• NCBI ID: WP_060552480.1
• Uniprot ID: -
• Organism: Staphylococcus agnetis strain IVB6187
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1267206..1277517

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA97_RS06195 (MUA97_06185)	-	1267982..1268185 (+)	204	WP_037567684.1	YqgQ family protein	-
MUA97_RS06200 (MUA97_06190)	-	1268182..1269168 (+)	987	WP_060551128.1	ROK family glucokinase	-
MUA97_RS06205 (MUA97_06195)	-	1269169..1269480 (+)	312	WP_060551127.1	MTH1187 family thiamine-binding protein	-
MUA97_RS06210 (MUA97_06200)	-	1269495..1270118 (+)	624	WP_107368912.1	MBL fold metallo-hydrolase	-
MUA97_RS06215 (MUA97_06205)	comGA	1270175..1271149 (+)	975	WP_060551125.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA97_RS06220 (MUA97_06210)	comGB	1271118..1272185 (+)	1068	WP_262608157.1	competence type IV pilus assembly protein ComGB	-
MUA97_RS06225 (MUA97_06215)	comGC	1272206..1272517 (+)	312	WP_060552480.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA97_RS06230 (MUA97_06220)	comGD	1272507..1272938 (+)	432	WP_225906114.1	competence type IV pilus minor pilin ComGD	-
MUA97_RS06235 (MUA97_06225)	-	1273130..1273612 (+)	483	WP_262608158.1	competence type IV pilus minor pilin ComGF	-
MUA97_RS06240 (MUA97_06230)	-	1273596..1273793 (+)	198	WP_037567695.1	hypothetical protein	-
MUA97_RS06245 (MUA97_06235)	-	1273732..1274301 (+)	570	WP_085622559.1	shikimate kinase	-
MUA97_RS06250 (MUA97_06240)	gcvT	1274453..1275544 (+)	1092	WP_060551123.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA97_RS06255 (MUA97_06245)	gcvPA	1275556..1276905 (+)	1350	WP_060551122.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11494.66 Da
• Isoelectric Point: 9.0689

>NTDB_id=673047 MUA97_RS06225 WP_060552480.1 1272206..1272517(+) (comGC) [Staphylococcus agnetis strain IVB6187]
MIHMLKNKKGFTLIEMLLVLLIISVLLILIIPNIAKQSEHIQKTGCAAQLKLVDSQIEAYTLKYNRKPATIEELVQEGYI
KENQKNCKSGESITIRGGEAIAS

Nucleotide

• Length: 312 bp

>NTDB_id=673047 MUA97_RS06225 WP_060552480.1 1272206..1272517(+) (comGC) [Staphylococcus agnetis strain IVB6187]
ATGATTCACATGCTAAAAAATAAAAAAGGATTCACGCTAATTGAAATGTTGCTTGTATTACTGATTATTAGCGTTTTATT
AATTTTAATTATCCCAAACATAGCTAAACAATCTGAACACATTCAAAAAACAGGATGTGCTGCACAACTTAAACTTGTTG
ACAGTCAAATAGAAGCATATACATTAAAATACAATCGTAAACCAGCAACTATAGAAGAACTTGTTCAAGAAGGTTATATT
AAGGAGAATCAAAAGAATTGTAAAAGTGGTGAAAGCATCACAATCCGTGGTGGCGAGGCTATTGCATCGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	68.932	100	0.689
comGC	Staphylococcus aureus MW2	68.932	100	0.689
comGC	Bacillus subtilis subsp. subtilis str. 168	44.086	90.291	0.398
comYC	Streptococcus suis isolate S10	52.632	73.786	0.388
comYC	Streptococcus gordonii str. Challis substr. CH1	50.633	76.699	0.388
comGC/cglC	Streptococcus mitis SK321	51.316	73.786	0.379
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	73.786	0.379
comGC/cglC	Streptococcus pneumoniae R6	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae TIGR4	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae Rx1	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae D39	50	73.786	0.369
comYC	Streptococcus mutans UA140	48.101	76.699	0.369
comYC	Streptococcus mutans UA159	48.101	76.699	0.369