Detailed information NTG0672952

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA71_RS07190
• Genome accession: NZ_CP094806
• Coordinates: 1462872..1463180 (+)
• Length: 102 a.a.
• NCBI ID: WP_103387866.1
• Uniprot ID: -
• Organism: Staphylococcus arlettae strain IVB6234
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1457872..1468180

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA71_RS07160 (MUA71_07125)	-	1458202..1458396 (+)	195	WP_262614780.1	YqgQ family protein	-
MUA71_RS07165 (MUA71_07130)	-	1458861..1459847 (+)	987	WP_002509762.1	glucokinase	-
MUA71_RS07170 (MUA71_07135)	-	1459847..1460185 (+)	339	WP_002509761.1	MTH1187 family thiamine-binding protein	-
MUA71_RS07175 (MUA71_07140)	-	1460172..1460789 (+)	618	WP_002509760.1	MBL fold metallo-hydrolase	-
MUA71_RS07180 (MUA71_07145)	comGA	1460842..1461816 (+)	975	WP_142019638.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA71_RS07185 (MUA71_07150)	comGB	1461788..1462840 (+)	1053	WP_193325328.1	competence type IV pilus assembly protein ComGB	-
MUA71_RS07190 (MUA71_07155)	comGC	1462872..1463180 (+)	309	WP_103387866.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA71_RS07195 (MUA71_07160)	comGD	1463170..1463607 (+)	438	WP_103387867.1	competence type IV pilus minor pilin ComGD	-
MUA71_RS07200 (MUA71_07165)	-	1463588..1463887 (+)	300	WP_002509755.1	hypothetical protein	-
MUA71_RS07205 (MUA71_07170)	-	1463862..1464290 (+)	429	WP_002509754.1	competence type IV pilus minor pilin ComGF	-
MUA71_RS07210 (MUA71_07175)	-	1464458..1464970 (+)	513	WP_002509752.1	shikimate kinase	-
MUA71_RS07215 (MUA71_07180)	gcvT	1465138..1466229 (+)	1092	WP_021459931.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA71_RS07220 (MUA71_07185)	gcvPA	1466248..1467600 (+)	1353	WP_002509750.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 102 a.a.
• Molecular weight: 11303.35 Da
• Isoelectric Point: 9.5423

>NTDB_id=672952 MUA71_RS07190 WP_103387866.1 1462872..1463180(+) (comGC) [Staphylococcus arlettae strain IVB6234]
MYKRTVTKAFTLIEMLLVLLIISLLLILIIPNIAKQSKHIQNTGCKAQLKMVDSQIEAYTLKNNQAPATIDDLVREGYIK
ENQKQCKSGANITITNGEAVAS

Nucleotide

• Length: 309 bp

>NTDB_id=672952 MUA71_RS07190 WP_103387866.1 1462872..1463180(+) (comGC) [Staphylococcus arlettae strain IVB6234]
ATGTATAAAAGAACTGTTACAAAAGCTTTTACATTAATAGAAATGTTACTCGTACTATTAATCATTAGTTTATTACTCAT
ACTAATAATCCCTAATATTGCAAAACAATCAAAGCATATACAAAATACAGGTTGTAAAGCACAATTAAAAATGGTCGATA
GCCAAATAGAAGCATACACATTAAAAAATAATCAAGCACCAGCAACAATAGATGACCTTGTTCGAGAGGGGTATATTAAA
GAGAATCAAAAACAATGTAAATCCGGTGCAAATATTACAATTACTAATGGTGAAGCTGTTGCTAGCTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	75	94.118	0.706
comGC	Staphylococcus aureus MW2	75	94.118	0.706
comYC	Streptococcus gordonii str. Challis substr. CH1	50	84.314	0.422
comYC	Streptococcus mutans UA140	50.617	79.412	0.402
comYC	Streptococcus mutans UA159	50.617	79.412	0.402
comGC	Bacillus subtilis subsp. subtilis str. 168	43.956	89.216	0.392
comYC	Streptococcus suis isolate S10	51.316	74.51	0.382
comGC/cglC	Streptococcus mitis NCTC 12261	46.914	79.412	0.373
comGC/cglC	Streptococcus mitis SK321	45.238	82.353	0.373
comGC/cglC	Streptococcus pneumoniae R6	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae D39	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae Rx1	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae TIGR4	44.048	82.353	0.363