Detailed information NTG0672919

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA37_RS06500
• Genome accession: NZ_CP094803
• Coordinates: 1338751..1339059 (+)
• Length: 102 a.a.
• NCBI ID: WP_103387866.1
• Uniprot ID: -
• Organism: Staphylococcus arlettae strain IVB6235
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1333751..1344059

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA37_RS06470 (MUA37_06465)	-	1334091..1334285 (+)	195	WP_262614780.1	YqgQ family protein	-
MUA37_RS06475 (MUA37_06470)	-	1334750..1335736 (+)	987	WP_002509762.1	glucokinase	-
MUA37_RS06480 (MUA37_06475)	-	1335736..1336074 (+)	339	WP_002509761.1	MTH1187 family thiamine-binding protein	-
MUA37_RS06485 (MUA37_06480)	-	1336061..1336678 (+)	618	WP_002509760.1	MBL fold metallo-hydrolase	-
MUA37_RS06490 (MUA37_06485)	comGA	1336745..1337695 (+)	951	WP_262624385.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA37_RS06495 (MUA37_06490)	comGB	1337667..1338719 (+)	1053	WP_262624386.1	competence type IV pilus assembly protein ComGB	-
MUA37_RS06500 (MUA37_06495)	comGC	1338751..1339059 (+)	309	WP_103387866.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA37_RS06505 (MUA37_06500)	comGD	1339049..1339486 (+)	438	WP_103387867.1	competence type IV pilus minor pilin ComGD	-
MUA37_RS06510 (MUA37_06505)	-	1339467..1339766 (+)	300	WP_002509755.1	hypothetical protein	-
MUA37_RS06515 (MUA37_06510)	-	1339741..1340169 (+)	429	WP_002509754.1	competence type IV pilus minor pilin ComGF	-
MUA37_RS06520 (MUA37_06515)	-	1340337..1340849 (+)	513	WP_002509752.1	shikimate kinase	-
MUA37_RS06525 (MUA37_06520)	gcvT	1341017..1342108 (+)	1092	WP_021459931.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA37_RS06530 (MUA37_06525)	gcvPA	1342127..1343479 (+)	1353	WP_002509750.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 102 a.a.
• Molecular weight: 11303.35 Da
• Isoelectric Point: 9.5423

>NTDB_id=672919 MUA37_RS06500 WP_103387866.1 1338751..1339059(+) (comGC) [Staphylococcus arlettae strain IVB6235]
MYKRTVTKAFTLIEMLLVLLIISLLLILIIPNIAKQSKHIQNTGCKAQLKMVDSQIEAYTLKNNQAPATIDDLVREGYIK
ENQKQCKSGANITITNGEAVAS

Nucleotide

• Length: 309 bp

>NTDB_id=672919 MUA37_RS06500 WP_103387866.1 1338751..1339059(+) (comGC) [Staphylococcus arlettae strain IVB6235]
ATGTATAAAAGAACTGTTACAAAAGCTTTTACATTAATAGAAATGTTACTCGTACTATTAATCATTAGTTTATTACTCAT
ACTAATAATCCCTAATATTGCAAAACAATCAAAGCATATACAAAATACAGGTTGTAAAGCACAATTAAAAATGGTCGATA
GCCAAATAGAAGCATACACATTAAAAAATAATCAAGCACCAGCAACAATAGATGACCTTGTTCGAGAGGGGTATATTAAA
GAGAATCAAAAACAATGTAAATCCGGTGCAAATATTACAATTACTAATGGTGAAGCTGTTGCTAGCTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	75	94.118	0.706
comGC	Staphylococcus aureus MW2	75	94.118	0.706
comYC	Streptococcus gordonii str. Challis substr. CH1	50	84.314	0.422
comYC	Streptococcus mutans UA140	50.617	79.412	0.402
comYC	Streptococcus mutans UA159	50.617	79.412	0.402
comGC	Bacillus subtilis subsp. subtilis str. 168	43.956	89.216	0.392
comYC	Streptococcus suis isolate S10	51.316	74.51	0.382
comGC/cglC	Streptococcus mitis NCTC 12261	46.914	79.412	0.373
comGC/cglC	Streptococcus mitis SK321	45.238	82.353	0.373
comGC/cglC	Streptococcus pneumoniae R6	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae D39	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae Rx1	44.048	82.353	0.363
comGC/cglC	Streptococcus pneumoniae TIGR4	44.048	82.353	0.363