NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	MUA61_RS06145	Genome accession	NZ_CP094715
Coordinates	1246753..1247064 (+)	Length	103 a.a.
NCBI ID	WP_029055749.1	Uniprot ID	-
Organism	Staphylococcus pasteuri strain IVB6198
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1241753..1252064

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA61_RS06115 (MUA61_06115)	-	1242533..1242736 (+)	204	WP_017636256.1	YqgQ family protein	-
MUA61_RS06120 (MUA61_06120)	-	1242733..1243719 (+)	987	WP_017636255.1	ROK family glucokinase	-
MUA61_RS06125 (MUA61_06125)	-	1243719..1244042 (+)	324	WP_017636254.1	MTH1187 family thiamine-binding protein	-
MUA61_RS06130 (MUA61_06130)	-	1244046..1244669 (+)	624	WP_017636253.1	MBL fold metallo-hydrolase	-
MUA61_RS06135 (MUA61_06135)	comGA	1244716..1245690 (+)	975	WP_262551452.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA61_RS06140 (MUA61_06140)	comGB	1245662..1246729 (+)	1068	WP_124760094.1	competence type IV pilus assembly protein ComGB	Machinery gene
MUA61_RS06145 (MUA61_06145)	comGC	1246753..1247064 (+)	312	WP_029055749.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA61_RS06150 (MUA61_06150)	comGD	1247042..1247491 (+)	450	WP_083279990.1	competence type IV pilus minor pilin ComGD	-
MUA61_RS06155 (MUA61_06155)	-	1247523..1247771 (+)	249	WP_185640402.1	hypothetical protein	-
MUA61_RS06160 (MUA61_06160)	-	1248345..1248863 (+)	519	WP_262551453.1	shikimate kinase	-
MUA61_RS06165 (MUA61_06165)	gcvT	1249035..1250126 (+)	1092	WP_124760093.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA61_RS06170 (MUA61_06170)	gcvPA	1250145..1251494 (+)	1350	WP_262551454.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11485.49 Da Isoelectric Point: 8.5268

                                >NTDB_id=671069 MUA61_RS06145 WP_029055749.1 1246753..1247064(+) (comGC) [Staphylococcus pasteuri strain IVB6198]

MFKTLFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQTTGCDAQVKMVNSQIEAYTLKHNRNPNTIQDLISEGFI

KENQKNCKSGETISINNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=671069 MUA61_RS06145 WP_029055749.1 1246753..1247064(+) (comGC) [Staphylococcus pasteuri strain IVB6198]

ATATTCAAAACACTGTTTAACAAAAAGGCATTTACATTAATTGAAATGTTACTAGTTTTATTAATAATTAGCTTATTGCT

TATTCTAATTATTCCCAATATAGCTAAACAAACCGCTCATATACAAACTACTGGTTGTGATGCTCAAGTGAAAATGGTTA

ATAGTCAAATTGAAGCATATACTTTAAAACATAATAGAAATCCTAATACCATCCAAGACTTAATTTCTGAAGGATTTATT

AAAGAAAACCAAAAAAATTGCAAATCAGGAGAAACTATTAGTATTAATAATGGCGAAGCGGTTGCAAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(7-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	83.495	100	0.835
comGC	Staphylococcus aureus MW2	83.495	100	0.835
comYC	Streptococcus gordonii str. Challis substr. CH1	45.361	94.175	0.427
comGC	Bacillus subtilis subsp. subtilis str. 168	43.617	91.262	0.398
comGC/cglC	Streptococcus pneumoniae R6	43.478	89.32	0.388
comGC/cglC	Streptococcus pneumoniae TIGR4	43.478	89.32	0.388
comGC/cglC	Streptococcus pneumoniae Rx1	43.478	89.32	0.388
comGC/cglC	Streptococcus pneumoniae D39	43.478	89.32	0.388
comGC/cglC	Streptococcus mitis NCTC 12261	42.105	92.233	0.388
comYC	Streptococcus suis isolate S10	51.316	73.786	0.379
comYC	Streptococcus mutans UA140	48.101	76.699	0.369
comYC	Streptococcus mutans UA159	48.101	76.699	0.369

Detailed information NTG0671069