Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | MP387_RS09105 | Genome accession | NZ_CP094226 |
| Coordinates | 1873440..1873565 (-) | Length | 41 a.a. |
| NCBI ID | WP_008282505.1 | Uniprot ID | A0A139Q4L7 |
| Organism | Streptococcus oralis strain 1648 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1868440..1878565
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MP387_RS09080 (MP387_09080) | - | 1870571..1871113 (+) | 543 | WP_000665080.1 | TetR-like C-terminal domain-containing protein | - |
| MP387_RS09095 (MP387_09095) | comE | 1871351..1872103 (-) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| MP387_RS09100 (MP387_09100) | comD | 1872100..1873419 (-) | 1320 | WP_242746613.1 | competence system sensor histidine kinase ComD | Regulator |
| MP387_RS09105 (MP387_09105) | comC/comC1 | 1873440..1873565 (-) | 126 | WP_008282505.1 | competence-stimulating peptide ComC | Regulator |
| MP387_RS09115 (MP387_09115) | rlmH | 1873847..1874326 (-) | 480 | WP_242746617.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| MP387_RS09120 (MP387_09120) | htrA | 1874512..1875705 (+) | 1194 | WP_242746621.1 | S1C family serine protease | Regulator |
| MP387_RS09125 (MP387_09125) | spo0J | 1875763..1876521 (+) | 759 | WP_242746624.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4957.73 Da Isoelectric Point: 10.2767
>NTDB_id=668137 MP387_RS09105 WP_008282505.1 1873440..1873565(-) (comC/comC1) [Streptococcus oralis strain 1648]
MKNTVKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
MKNTVKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
Nucleotide
Download Length: 126 bp
>NTDB_id=668137 MP387_RS09105 WP_008282505.1 1873440..1873565(-) (comC/comC1) [Streptococcus oralis strain 1648]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis SK321 |
68.966 |
70.732 |
0.488 |
| comC/comC2 | Streptococcus pneumoniae A66 |
58.621 |
70.732 |
0.415 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
58.621 |
70.732 |
0.415 |
| comC | Streptococcus mitis NCTC 12261 |
55.556 |
65.854 |
0.366 |
| comC/blpC | Streptococcus mutans UA159 |
44.118 |
82.927 |
0.366 |