Detailed information    

insolico Bioinformatically predicted

Overview

Name   dinR/lexA   Type   Regulator
Locus tag   OG372_RS01670 Genome accession   NZ_CP108681
Coordinates   377301..377450 (+) Length   49 a.a.
NCBI ID   WP_406067353.1    Uniprot ID   -
Organism   Streptomyces sp. NBC_01020     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context

Location: 372301..382450
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OG372_RS01650 (OG372_01650) - 373768..374928 (-) 1161 WP_401605501.1 glutathione-independent formaldehyde dehydrogenase -
  OG372_RS01655 (OG372_01655) - 375286..375669 (-) 384 WP_405911611.1 ArsR/SmtB family transcription factor -
  OG372_RS01660 (OG372_01660) - 375898..376869 (+) 972 WP_405914292.1 cation diffusion facilitator family transporter -
  OG372_RS01665 (OG372_01665) - 377013..377252 (+) 240 WP_406067351.1 hypothetical protein -
  OG372_RS01670 (OG372_01670) dinR/lexA 377301..377450 (+) 150 WP_406067353.1 hypothetical protein Regulator
  OG372_RS01675 (OG372_01675) - 377524..378006 (+) 483 Protein_334 transposase -
  OG372_RS01680 (OG372_01685) - 378283..378468 (-) 186 WP_406067355.1 hypothetical protein -
  OG372_RS01685 (OG372_01690) - 378631..379239 (-) 609 WP_406067356.1 TetR/AcrR family transcriptional regulator -
  OG372_RS01690 (OG372_01695) - 379287..379784 (+) 498 WP_406067358.1 SRPBCC family protein -
  OG372_RS01695 (OG372_01700) arsB 379785..380876 (-) 1092 WP_401605521.1 ACR3 family arsenite efflux transporter -
  OG372_RS01700 (OG372_01705) - 380873..381271 (-) 399 WP_266860023.1 helix-turn-helix transcriptional regulator -
  OG372_RS01705 (OG372_01710) - 381350..381823 (+) 474 WP_266860021.1 ArsI/CadI family heavy metal resistance metalloenzyme -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5480.16 Da        Isoelectric Point: 9.1537

>NTDB_id=665022 OG372_RS01670 WP_406067353.1 377301..377450(+) (dinR/lexA) [Streptomyces sp. NBC_01020]
MAEHGRCPTMREIGNAVGLPSTSSVNYQLRRLQAQGFVTRTAQGWQPYD

Nucleotide


Download         Length: 150 bp        

>NTDB_id=665022 OG372_RS01670 WP_406067353.1 377301..377450(+) (dinR/lexA) [Streptomyces sp. NBC_01020]
GTGGCAGAGCACGGGCGCTGCCCGACCATGCGCGAGATCGGCAATGCCGTCGGCCTGCCCAGCACGTCGTCCGTGAACTA
CCAGCTGCGGCGCCTACAGGCCCAGGGGTTCGTCACCCGCACCGCCCAGGGATGGCAGCCGTACGATTAG

Domains

Predicted by InterProScan.

LexA DNA binding domain (LexA_DNA_bind)

(2-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

50

73.469

0.367