Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | MPF55_RS05450 | Genome accession | NZ_CP093527 |
| Coordinates | 1093459..1093770 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 697R | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1088459..1098770
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPF55_RS05420 (MPF55_05420) | - | 1089242..1089445 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| MPF55_RS05425 (MPF55_05425) | - | 1089442..1090428 (+) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| MPF55_RS05430 (MPF55_05430) | - | 1090428..1090757 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| MPF55_RS05435 (MPF55_05435) | - | 1090754..1091377 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| MPF55_RS05440 (MPF55_05440) | comGA | 1091429..1092403 (+) | 975 | WP_000697218.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| MPF55_RS05445 (MPF55_05445) | comGB | 1092375..1093445 (+) | 1071 | WP_000776407.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| MPF55_RS05450 (MPF55_05450) | comGC | 1093459..1093770 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| MPF55_RS05455 (MPF55_05455) | comGD | 1093748..1094194 (+) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MPF55_RS05460 (MPF55_05460) | comGE | 1094181..1094480 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| MPF55_RS05465 (MPF55_05465) | comGF | 1094398..1094895 (+) | 498 | WP_001838632.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| MPF55_RS05470 (MPF55_05470) | - | 1094992..1095138 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| MPF55_RS05475 (MPF55_05475) | - | 1095128..1095652 (+) | 525 | WP_001015116.1 | shikimate kinase | - |
| MPF55_RS05480 (MPF55_05480) | gcvT | 1095811..1096902 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MPF55_RS05485 (MPF55_05485) | gcvPA | 1096922..1098268 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=665022 MPF55_RS05450 WP_000472256.1 1093459..1093770(+) (comGC) [Staphylococcus aureus strain 697R]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=665022 MPF55_RS05450 WP_000472256.1 1093459..1093770(+) (comGC) [Staphylococcus aureus strain 697R]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |