Detailed information
Overview
| Name | pilT | Type | Machinery gene |
| Locus tag | OG295_RS31160 | Genome accession | NZ_CP108442 |
| Coordinates | 6911327..6911530 (+) | Length | 67 a.a. |
| NCBI ID | WP_371679942.1 | Uniprot ID | - |
| Organism | Streptomyces sp. NBC_01276 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 6906327..6916530
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OG295_RS31135 (OG295_31110) | - | 6907239..6907661 (+) | 423 | WP_371679939.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| OG295_RS31140 | - | 6907805..6907959 (+) | 155 | Protein_6130 | MerR family transcriptional regulator | - |
| OG295_RS31145 (OG295_31115) | modA | 6907994..6908815 (+) | 822 | WP_371679940.1 | molybdate ABC transporter substrate-binding protein | - |
| OG295_RS31150 (OG295_31120) | - | 6908912..6910837 (+) | 1926 | WP_371679941.1 | ABC transporter permease | - |
| OG295_RS31155 (OG295_31125) | - | 6910945..6911082 (-) | 138 | Protein_6133 | PucR family transcriptional regulator | - |
| OG295_RS31160 (OG295_31130) | pilT | 6911327..6911530 (+) | 204 | WP_371679942.1 | hypothetical protein | Machinery gene |
| OG295_RS31165 (OG295_31135) | - | 6912049..6912792 (-) | 744 | WP_371681361.1 | DUF6071 family protein | - |
| OG295_RS31170 (OG295_31140) | - | 6912798..6914264 (-) | 1467 | WP_371679943.1 | carbamoyltransferase C-terminal domain-containing protein | - |
| OG295_RS31175 (OG295_31145) | - | 6914494..6916182 (+) | 1689 | WP_371679944.1 | alpha-amylase family glycosyl hydrolase | - |
Sequence
Protein
Download Length: 67 a.a. Molecular weight: 7409.64 Da Isoelectric Point: 12.5033
>NTDB_id=660791 OG295_RS31160 WP_371679942.1 6911327..6911530(+) (pilT) [Streptomyces sp. NBC_01276]
MFPSGQQPQIRLQLAQTLVGILNQTLILRTGGGRVAAFEVPVGTAAIRNLIREGKNRVRDLSRRREA
MFPSGQQPQIRLQLAQTLVGILNQTLILRTGGGRVAAFEVPVGTAAIRNLIREGKNRVRDLSRRREA
Nucleotide
Download Length: 204 bp
>NTDB_id=660791 OG295_RS31160 WP_371679942.1 6911327..6911530(+) (pilT) [Streptomyces sp. NBC_01276]
GTGTTTCCGTCCGGGCAACAGCCGCAGATCCGGCTGCAATTGGCGCAGACCCTGGTCGGCATCCTCAACCAGACGCTCAT
CCTCCGGACCGGCGGGGGCCGGGTGGCCGCCTTCGAGGTGCCGGTGGGCACGGCGGCGATCCGCAACCTGATCCGCGAGG
GCAAGAACCGAGTGCGAGATCTGTCACGGCGGCGCGAAGCTTGA
GTGTTTCCGTCCGGGCAACAGCCGCAGATCCGGCTGCAATTGGCGCAGACCCTGGTCGGCATCCTCAACCAGACGCTCAT
CCTCCGGACCGGCGGGGGCCGGGTGGCCGCCTTCGAGGTGCCGGTGGGCACGGCGGCGATCCGCAACCTGATCCGCGAGG
GCAAGAACCGAGTGCGAGATCTGTCACGGCGGCGCGAAGCTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilT | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
50.877 |
85.075 |
0.433 |
| pilT | Pseudomonas aeruginosa PAK |
50.909 |
82.09 |
0.418 |
| pilT | Pseudomonas stutzeri DSM 10701 |
49.091 |
82.09 |
0.403 |
| pilT | Acinetobacter baylyi ADP1 |
49.091 |
82.09 |
0.403 |
| pilT | Acinetobacter baumannii D1279779 |
47.273 |
82.09 |
0.388 |
| pilT | Acinetobacter nosocomialis M2 |
47.273 |
82.09 |
0.388 |
| pilT | Acinetobacter baumannii strain A118 |
47.273 |
82.09 |
0.388 |
| pilT | Vibrio cholerae O1 biovar El Tor strain E7946 |
45.455 |
82.09 |
0.373 |
| pilT | Vibrio cholerae strain A1552 |
45.455 |
82.09 |
0.373 |