Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | L5I25_RS01935 | Genome accession | NZ_CP091895 |
| Coordinates | 379366..379824 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain 119-2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 370954..430099 | 379366..379824 | within | 0 |
Gene organization within MGE regions
Location: 370954..430099
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L5I25_RS01870 (L5I25_01870) | prgU | 371507..371863 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| L5I25_RS01875 (L5I25_01875) | - | 371885..372271 (+) | 387 | WP_002377929.1 | hypothetical protein | - |
| L5I25_RS01880 (L5I25_01880) | - | 372417..372677 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| L5I25_RS01885 (L5I25_01885) | - | 372688..373566 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| L5I25_RS01890 (L5I25_01890) | - | 373586..374446 (+) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| L5I25_RS01895 (L5I25_01895) | - | 374472..375742 (+) | 1271 | Protein_351 | CHAP domain-containing protein | - |
| L5I25_RS01900 (L5I25_01900) | - | 375745..376362 (+) | 618 | WP_002377936.1 | hypothetical protein | - |
| L5I25_RS01905 (L5I25_01905) | - | 376346..376762 (+) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| L5I25_RS01910 (L5I25_01910) | - | 376762..377076 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| L5I25_RS01915 (L5I25_01915) | - | 377069..378103 (+) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| L5I25_RS01920 (L5I25_01920) | - | 378108..378368 (+) | 261 | WP_010706916.1 | hypothetical protein | - |
| L5I25_RS01925 (L5I25_01925) | - | 378368..378757 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| L5I25_RS01930 (L5I25_01930) | - | 378789..379271 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| L5I25_RS01935 (L5I25_01935) | ssb | 379366..379824 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| L5I25_RS01940 (L5I25_01940) | - | 379929..382421 (+) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| L5I25_RS01945 (L5I25_01945) | - | 382378..382776 (+) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| L5I25_RS01950 (L5I25_01950) | - | 382789..385134 (+) | 2346 | WP_002377940.1 | CD3337/EF1877 family mobilome membrane protein | - |
| L5I25_RS01955 (L5I25_01955) | - | 385121..387379 (+) | 2259 | WP_010710132.1 | type IV secretory system conjugative DNA transfer family protein | - |
| L5I25_RS01960 (L5I25_01960) | - | 387902..388687 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| L5I25_RS01965 (L5I25_01965) | - | 388693..389181 (+) | 489 | WP_010710133.1 | hypothetical protein | - |
| L5I25_RS01970 (L5I25_01970) | - | 389773..390039 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| L5I25_RS01975 (L5I25_01975) | - | 390072..390572 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| L5I25_RS01980 (L5I25_01980) | - | 390585..390833 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| L5I25_RS01985 (L5I25_01985) | - | 390909..391325 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| L5I25_RS01990 (L5I25_01990) | - | 391349..391933 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| L5I25_RS01995 (L5I25_01995) | - | 392044..392310 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| L5I25_RS02000 (L5I25_02000) | - | 392303..392578 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| L5I25_RS02005 (L5I25_02005) | - | 392769..393413 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| L5I25_RS02010 (L5I25_02010) | - | 393546..394428 (+) | 883 | Protein_374 | IS256 family transposase | - |
| L5I25_RS02015 (L5I25_02015) | - | 394733..395770 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| L5I25_RS02020 (L5I25_02020) | - | 395796..396734 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| L5I25_RS02025 (L5I25_02025) | - | 396862..397131 (-) | 270 | Protein_377 | LPXTG cell wall anchor domain-containing protein | - |
| L5I25_RS02030 (L5I25_02030) | - | 397221..397406 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| L5I25_RS02035 (L5I25_02035) | - | 397438..398046 (+) | 609 | Protein_379 | IS6 family transposase | - |
| L5I25_RS02040 (L5I25_02040) | bsh | 398715..399689 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| L5I25_RS02045 (L5I25_02045) | - | 399913..400557 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| L5I25_RS02050 (L5I25_02050) | - | 400730..401044 (+) | 315 | WP_002403043.1 | hypothetical protein | - |
| L5I25_RS02055 (L5I25_02055) | cylR2 | 401382..401582 (-) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| L5I25_RS02060 (L5I25_02060) | cylL-L | 401986..402192 (+) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| L5I25_RS02065 (L5I25_02065) | cylL-S | 402226..402417 (+) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| L5I25_RS02070 (L5I25_02070) | - | 402478..405459 (+) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| L5I25_RS02075 (L5I25_02075) | - | 405471..407615 (+) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| L5I25_RS02080 (L5I25_02080) | - | 407612..408850 (+) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| L5I25_RS14045 | - | 408869..409210 (+) | 342 | WP_324252328.1 | site-2 protease family protein | - |
| L5I25_RS02085 (L5I25_02085) | - | 410188..410751 (+) | 564 | WP_002370925.1 | hypothetical protein | - |
| L5I25_RS02090 (L5I25_02090) | - | 411188..411655 (+) | 468 | WP_002370921.1 | hypothetical protein | - |
| L5I25_RS02095 (L5I25_02095) | - | 411733..412314 (+) | 582 | WP_002401490.1 | hypothetical protein | - |
| L5I25_RS02100 (L5I25_02100) | - | 412409..412615 (+) | 207 | WP_229017897.1 | S41 family peptidase | - |
| L5I25_RS02105 (L5I25_02105) | amaP | 412885..413451 (+) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| L5I25_RS02110 (L5I25_02110) | - | 413468..413659 (+) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| L5I25_RS02115 (L5I25_02115) | - | 413688..414224 (+) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| L5I25_RS02120 (L5I25_02120) | - | 414499..420120 (+) | 5622 | WP_108095647.1 | Rib/alpha-like domain-containing protein | - |
| L5I25_RS02125 (L5I25_02125) | - | 420320..421528 (+) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| L5I25_RS02130 (L5I25_02130) | - | 421658..422074 (+) | 417 | WP_002358522.1 | hypothetical protein | - |
| L5I25_RS02135 (L5I25_02135) | - | 422210..422311 (-) | 102 | Protein_400 | IS30 family transposase | - |
| L5I25_RS02140 (L5I25_02140) | - | 422299..423036 (+) | 738 | WP_002401428.1 | hypothetical protein | - |
| L5I25_RS02145 (L5I25_02145) | - | 423082..423702 (-) | 621 | WP_033591050.1 | recombinase family protein | - |
| L5I25_RS02150 (L5I25_02150) | - | 423886..424505 (+) | 620 | Protein_403 | recombinase family protein | - |
| L5I25_RS02155 (L5I25_02155) | - | 425252..426070 (-) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| L5I25_RS02160 (L5I25_02160) | - | 426225..426932 (+) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| L5I25_RS02165 (L5I25_02165) | - | 426925..428427 (+) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| L5I25_RS02170 (L5I25_02170) | - | 428438..428920 (+) | 483 | WP_002358535.1 | PTS sugar transporter subunit IIA | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=654419 L5I25_RS01935 WP_002365911.1 379366..379824(+) (ssb) [Enterococcus faecalis strain 119-2]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=654419 L5I25_RS01935 WP_002365911.1 379366..379824(+) (ssb) [Enterococcus faecalis strain 119-2]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |