Detailed information NTG0064779

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: SCAZ3_RS05565
• Genome accession: NZ_AIDX01000001
• Coordinates: 1156426..1156752 (+)
• Length: 108 a.a.
• NCBI ID: WP_003046186.1
• Uniprot ID: -
• Organism: Streptococcus canis FSL Z3-227
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1151426..1161752

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SCAZ3_RS05550 (SCAZ3_00925)	-	1154063..1154428 (+)	366	WP_003046179.1	DUF1033 family protein	-
SCAZ3_RS05555 (SCAZ3_00930)	comYA	1154515..1155456 (+)	942	WP_003046182.1	competence type IV pilus ATPase ComGA	Machinery gene
SCAZ3_RS05560 (SCAZ3_00935)	comYB	1155389..1156423 (+)	1035	WP_223824829.1	competence type IV pilus assembly protein ComGB	Machinery gene
SCAZ3_RS05565 (SCAZ3_00940)	comGC/cglC	1156426..1156752 (+)	327	WP_003046186.1	competence type IV pilus major pilin ComGC	Machinery gene
SCAZ3_RS05570 (SCAZ3_00945)	comGD	1156727..1157155 (+)	429	WP_039994748.1	competence type IV pilus minor pilin ComGD	-
SCAZ3_RS05575 (SCAZ3_00950)	comGE	1157133..1157408 (+)	276	WP_003046190.1	competence type IV pilus minor pilin ComGE	-
SCAZ3_RS05580 (SCAZ3_00955)	comGF	1157389..1157829 (+)	441	WP_003046192.1	competence type IV pilus minor pilin ComGF	-
SCAZ3_RS05585 (SCAZ3_00960)	comGG	1157807..1158187 (+)	381	WP_003046193.1	competence type IV pilus minor pilin ComGG	-
SCAZ3_RS05590 (SCAZ3_00965)	comYH	1158237..1159190 (+)	954	WP_003046195.1	class I SAM-dependent methyltransferase	Machinery gene
SCAZ3_RS05595 (SCAZ3_00970)	-	1159249..1160445 (+)	1197	WP_003046198.1	acetate kinase	-
SCAZ3_RS05600 (SCAZ3_00975)	-	1160768..1160974 (+)	207	WP_003046200.1	helix-turn-helix transcriptional regulator	-
SCAZ3_RS05605 (SCAZ3_00980)	-	1161132..1161503 (+)	372	WP_003046201.1	hypothetical protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12391.29 Da
• Isoelectric Point: 9.3348

>NTDB_id=64779 SCAZ3_RS05565 WP_003046186.1 1156426..1156752(+) (comGC/cglC) [Streptococcus canis FSL Z3-227]
MTNQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDRVTETGHTAVVKLVENQAELYELSQGSKPSLSQLKE
DGSITDKQEKAYRDYYGKHKDEKASLND

Nucleotide

• Length: 327 bp

>NTDB_id=64779 SCAZ3_RS05565 WP_003046186.1 1156426..1156752(+) (comGC/cglC) [Streptococcus canis FSL Z3-227]
ATGACAAACCAATGGAACAACTTACGACACAAGAAGCTAAAAGGATTTACTCTTCTTGAAATGTTATTGGTGATTCTTGT
CATCAGTGTTTTGATGCTATTATTTGTGCCAAATTTAAGCAAGCAAAAAGACAGGGTTACCGAGACAGGTCATACCGCTG
TTGTTAAATTAGTGGAGAATCAAGCGGAGCTATATGAATTATCTCAGGGTTCAAAACCAAGTTTGAGCCAACTGAAGGAA
GATGGTAGCATCACTGACAAACAAGAAAAAGCTTATCGCGACTATTATGGCAAACATAAAGATGAAAAAGCCAGTCTTAA
TGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (12-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	55.446	93.519	0.519
comYC	Streptococcus gordonii str. Challis substr. CH1	56.566	91.667	0.519
comGC	Lactococcus lactis subsp. cremoris KW2	54.902	94.444	0.519
comGC/cglC	Streptococcus pneumoniae R6	50.926	100	0.509
comGC/cglC	Streptococcus pneumoniae Rx1	50.926	100	0.509
comGC/cglC	Streptococcus pneumoniae D39	50.926	100	0.509
comGC/cglC	Streptococcus pneumoniae TIGR4	53.465	93.519	0.5
comGC/cglC	Streptococcus mitis NCTC 12261	57.609	85.185	0.491
comYC	Streptococcus mutans UA140	58.621	80.556	0.472
comYC	Streptococcus mutans UA159	58.621	80.556	0.472
comYC	Streptococcus suis isolate S10	52.273	81.481	0.426