NTDB

Overview

Name	comEA	Type	Machinery gene
Locus tag	LXN10_RS14975	Genome accession	NZ_CP090177
Coordinates	3009739..3009984 (-)	Length	81 a.a.
NCBI ID	WP_375723785.1	Uniprot ID	-
Organism	Arcobacter sp. KX21116
Function	dsDNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3004739..3014984

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LXN10_RS14935 (LXN10_14890)	ribA	3005257..3005820 (+)	564	WP_375723778.1	GTP cyclohydrolase II	-
LXN10_RS14940 (LXN10_14895)	rsmG	3005820..3006404 (+)	585	WP_375723779.1	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	-
LXN10_RS14945 (LXN10_14900)	-	3006404..3006625 (+)	222	WP_375723780.1	PP0621 family protein	-
LXN10_RS14950 (LXN10_14905)	-	3006622..3006993 (+)	372	WP_375723781.1	hypothetical protein	-
LXN10_RS14955 (LXN10_14910)	-	3006996..3007142 (+)	147	WP_013135477.1	hypothetical protein	-
LXN10_RS14960 (LXN10_14915)	glyS	3007135..3009150 (+)	2016	WP_375723782.1	glycine--tRNA ligase subunit beta	-
LXN10_RS14965 (LXN10_14920)	-	3009160..3009300 (+)	141	WP_375723783.1	entericidin EcnAB	-
LXN10_RS14970 (LXN10_14925)	-	3009325..3009606 (-)	282	WP_375723784.1	hypothetical protein	-
LXN10_RS14975 (LXN10_14930)	comEA	3009739..3009984 (-)	246	WP_375723785.1	ComEA family DNA-binding protein	Machinery gene
LXN10_RS14980 (LXN10_14935)	-	3010081..3010581 (-)	501	WP_375723786.1	nucleoside 2-deoxyribosyltransferase	-
LXN10_RS14985 (LXN10_14940)	-	3010608..3011507 (-)	900	WP_375723787.1	uroporphyrinogen-III synthase	-
LXN10_RS15000 (LXN10_14955)	-	3011875..3012906 (+)	1032	WP_375723788.1	bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II	-
LXN10_RS15005 (LXN10_14960)	-	3012926..3013414 (-)	489	WP_129099271.1	hypothetical protein	-

Sequence

Protein

Download Length: 81 a.a. Molecular weight: 9035.87 Da Isoelectric Point: 9.9399

                                >NTDB_id=640951 LXN10_RS14975 WP_375723785.1 3009739..3009984(-) (comEA) [Arcobacter sp. KX21116]

MKIILVLVLFCLALFAIDMNKASVEELKTLNGIGAKKAEAIVHYRTEHKCFKNKDDLLNVKGIGKKLLEKNEGKISFSAC

K

Nucleotide

Download Length: 246 bp

                                >NTDB_id=640951 LXN10_RS14975 WP_375723785.1 3009739..3009984(-) (comEA) [Arcobacter sp. KX21116]

ATGAAAATTATTTTGGTACTAGTGCTGTTTTGTTTGGCTTTATTTGCAATTGACATGAATAAAGCTTCTGTTGAGGAATT

AAAAACACTAAATGGAATTGGAGCTAAAAAAGCTGAAGCAATCGTTCACTACAGAACTGAACATAAGTGTTTTAAAAATA

AAGATGACCTTTTAAATGTAAAAGGCATAGGAAAAAAACTTTTAGAAAAAAATGAAGGTAAAATCTCATTTTCTGCTTGT

AAATAA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(17-75)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comEA	Vibrio parahaemolyticus RIMD 2210633	45.263	100	0.531
comEA	Vibrio campbellii strain DS40M4	39.785	100	0.457
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	48	92.593	0.444
comE	Neisseria gonorrhoeae MS11	43.75	98.765	0.432
comE	Neisseria gonorrhoeae MS11	43.75	98.765	0.432
comE	Neisseria gonorrhoeae MS11	43.75	98.765	0.432
comE	Neisseria gonorrhoeae MS11	43.75	98.765	0.432
comE1/comEA	Haemophilus influenzae Rd KW20	54.839	76.543	0.42
comEA	Vibrio cholerae C6706	49.206	77.778	0.383
comEA	Vibrio cholerae strain A1552	49.206	77.778	0.383
comEA	Acinetobacter baumannii D1279779	50	74.074	0.37
comEA	Latilactobacillus sakei subsp. sakei 23K	50.847	72.84	0.37

Detailed information NTG0640951